Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (12 Aug 2020)
Sequence version 2 (03 Oct 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Leukocyte immunoglobulin-like receptor subfamily A member 2

Gene

LILRA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Part of the innate immune responses against microbial infection (PubMed:12529506, PubMed:27572839). Specifically recognizes a set of N-terminally truncated immunoglobulins that are produced via cleavage by proteases from a range of pathogenic bacteria and fungi, including L.pneumophila, M.hyorhinis, S.pneumoniae, S.aureus and C.albicans (PubMed:27572839). Recognizes epitopes that are in part in the variable region of the immunoglobulin light chains, but requires also the constant region for signaling (PubMed:27572839). Binds to a subset of cleaved IgM, IgG3 and IgG4 molecules, but does not bind cleaved IgA1 (PubMed:27572839). Binding of N-terminally truncated immunoglobulins mediates activation of neutrophils (PubMed:27572839). In monocytes, activation leads to the release of CSF2, CF3, IL6, CXCL8 and CCL3 and down-regulates responses to bacterial lipopolysaccharide (LPS), possibly via down-regulation of TLR4 expression and reduced signaling via TLR4 (PubMed:22479404). In eosinophils, activation by ligand binding leads to the release of RNASE2, IL4 and leukotriene C4 (PubMed:12529506). Does not bind class I MHC antigens (PubMed:19230061).4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processImmunity, Innate immunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N149

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leukocyte immunoglobulin-like receptor subfamily A member 2
Alternative name(s):
CD85 antigen-like family member H
Immunoglobulin-like transcript 1
Short name:
ILT-1
Leukocyte immunoglobulin-like receptor 71 Publication
Short name:
LIR-71 Publication
CD_antigen: CD85h
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LILRA2
Synonyms:ILT1, LIR7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000239998.5

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6603, LILRA2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604812, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N149

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 449ExtracellularSequence analysisAdd BLAST426
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei450 – 470HelicalSequence analysisAdd BLAST21
Topological domaini471 – 483CytoplasmicSequence analysisAdd BLAST13

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
11027

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30377

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N149, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LILRA2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
37537906

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001481724 – 483Leukocyte immunoglobulin-like receptor subfamily A member 2Add BLAST460

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi49 ↔ 97PROSITE-ProRule annotation1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi64N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi138N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi143 ↔ 195PROSITE-ProRule annotation1 Publication
Disulfide bondi244 ↔ 295PROSITE-ProRule annotation
Glycosylationi279N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi300N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi339N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi344 ↔ 395PROSITE-ProRule annotation
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei4043'-nitrotyrosineBy similarity1
Glycosylationi429N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Nitration

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N149

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N149

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N149

PeptideAtlas

More...
PeptideAtlasi
Q8N149

PRoteomics IDEntifications database

More...
PRIDEi
Q8N149

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
71558 [Q8N149-1]
71559 [Q8N149-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q8N149, 7 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N149

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N149

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected on the surface of all peripheral blood monocytes, neutrophils, basophils and eosinophils (at protein level) (PubMed:12529506, PubMed:22479404). Expression levels are very low or not detectable on monocytes, T-cells, B-cells, dendritic cells and natural killer (NK) cells (PubMed:9548455).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000239998, Expressed in blood and 182 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N149, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N149, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000239998, Group enriched (blood, bone marrow, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

1 Publication

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000251377

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N149, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1483
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N149

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8N149

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 113Ig-like C2-type 1Add BLAST87
Domaini117 – 222Ig-like C2-type 2Add BLAST106
Domaini224 – 313Ig-like C2-type 3Add BLAST90
Domaini324 – 413Ig-like C2-type 4Add BLAST90

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RYEX, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_021100_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N149

KEGG Orthology (KO)

More...
KOi
K06512

Database of Orthologous Groups

More...
OrthoDBi
1000446at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N149

TreeFam database of animal gene trees

More...
TreeFami
TF336644

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016332, A1B_glyco/leuk_Ig-like_rcpt
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013151, Immunoglobulin

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00047, ig, 1 hit
PF13895, Ig_2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001979, Alpha_1B_glycoprot_prd, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409, IG, 4 hits
SM00408, IGc2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835, IG_LIKE, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N149-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTPILTVLIC LGLSLGPRTH VQAGHLPKPT LWAEPGSVII QGSPVTLRCQ
60 70 80 90 100
GSLQAEEYHL YRENKSASWV RRIQEPGKNG QFPIPSITWE HAGRYHCQYY
110 120 130 140 150
SHNHSSEYSD PLELVVTGAY SKPTLSALPS PVVTLGGNVT LQCVSQVAFD
160 170 180 190 200
GFILCKEGED EHPQRLNSHS HARGWSWAIF SVGPVSPSRR WSYRCYAYDS
210 220 230 240 250
NSPYVWSLPS DLLELLVPGV SKKPSLSVQP GPMVAPGESL TLQCVSDVGY
260 270 280 290 300
DRFVLYKEGE RDFLQRPGWQ PQAGLSQANF TLGPVSPSHG GQYRCYSAHN
310 320 330 340 350
LSSEWSAPSD PLDILITGQF YDRPSLSVQP VPTVAPGKNV TLLCQSRGQF
360 370 380 390 400
HTFLLTKEGA GHPPLHLRSE HQAQQNQAEF RMGPVTSAHV GTYRCYSSLS
410 420 430 440 450
SNPYLLSLPS DPLELVVSEA AETLSPSQNK TDSTTTSLGQ HPQDYTVENL
460 470 480
IRMGVAGLVL VVLGILLFEA QHSQRSLQDA AGR
Length:483
Mass (Da):52,992
Last modified:October 3, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6B57FFC81F8CCF6C
GO
Isoform 2 (identifier: Q8N149-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     419-436: EAAETLSPSQNKTDSTTT → A

Show »
Length:466
Mass (Da):51,200
Checksum:i29D7B30893D3F5D4
GO
Isoform 3 (identifier: Q8N149-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-23: Missing.
     436-483: TSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR → SE

Show »
Length:425
Mass (Da):46,806
Checksum:i4FAE03B1B83C6B1F
GO
Isoform 4 (identifier: Q8N149-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     436-483: TSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR → SE

Show »
Length:437
Mass (Da):48,023
Checksum:iFE62281A2EAC8AC9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MZH0A8MZH0_HUMAN
Leukocyte immunoglobulin-like recep...
LILRA2
454Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JMC9A0A0G2JMC9_HUMAN
Leukocyte immunoglobulin-like recep...
LILRA2
490Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JMW8A0A0G2JMW8_HUMAN
Leukocyte immunoglobulin-like recep...
LILRA2
454Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PDF4E9PDF4_HUMAN
Leukocyte immunoglobulin-like recep...
LILRA2
327Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SFC7A0A0D9SFC7_HUMAN
Leukocyte immunoglobulin-like recep...
LILRA2
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JMR2A0A0G2JMR2_HUMAN
Leukocyte immunoglobulin-like recep...
LILRA2
327Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WT41A0A087WT41_HUMAN
Leukocyte immunoglobulin-like recep...
LILRA2
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01698825H → L. Corresponds to variant dbSNP:rs1834697Ensembl.1
Natural variantiVAR_01698925H → N. Corresponds to variant dbSNP:rs1834698Ensembl.1
Natural variantiVAR_056051331V → G. Corresponds to variant dbSNP:rs7249811Ensembl.1
Natural variantiVAR_056052361G → A. Corresponds to variant dbSNP:rs7249154Ensembl.1
Natural variantiVAR_056053381R → C. Corresponds to variant dbSNP:rs7249054Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05708512 – 23Missing in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_008455419 – 436EAAET…DSTTT → A in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_057086436 – 483TSLGQ…DAAGR → SE in isoform 3 and isoform 4. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF025531 mRNA Translation: AAB87665.1
EU915609 mRNA Translation: ACK56075.1
EU915610 mRNA Translation: ACK56076.1
BC017412 mRNA Translation: AAH17412.1
BC027916 mRNA Translation: AAH27916.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12900.1 [Q8N149-2]
CCDS46179.1 [Q8N149-1]

NCBI Reference Sequences

More...
RefSeqi
NP_006857.2, NM_006866.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000251376; ENSP00000251376; ENSG00000239998
ENST00000251377; ENSP00000251377; ENSG00000239998
ENST00000391738; ENSP00000375618; ENSG00000239998
ENST00000611940; ENSP00000478981; ENSG00000275290 [Q8N149-1]
ENST00000613573; ENSP00000479743; ENSG00000275290 [Q8N149-2]
ENST00000616629; ENSP00000481338; ENSG00000275290 [Q8N149-1]
ENST00000617409; ENSP00000479914; ENSG00000274000 [Q8N149-1]
ENST00000620279; ENSP00000480939; ENSG00000274000 [Q8N149-2]
ENST00000621721; ENSP00000484762; ENSG00000278634 [Q8N149-2]
ENST00000622640; ENSP00000483906; ENSG00000278634 [Q8N149-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11027

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11027

UCSC genome browser

More...
UCSCi
uc002qgf.5, human [Q8N149-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF025531 mRNA Translation: AAB87665.1
EU915609 mRNA Translation: ACK56075.1
EU915610 mRNA Translation: ACK56076.1
BC017412 mRNA Translation: AAH17412.1
BC027916 mRNA Translation: AAH27916.1
CCDSiCCDS12900.1 [Q8N149-2]
CCDS46179.1 [Q8N149-1]
RefSeqiNP_006857.2, NM_006866.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OTPX-ray2.60A/B24-219[»]
SMRiQ8N149
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000251377

PTM databases

GlyGeniQ8N149, 7 sites
iPTMnetiQ8N149
PhosphoSitePlusiQ8N149

Polymorphism and mutation databases

BioMutaiLILRA2
DMDMi37537906

Proteomic databases

jPOSTiQ8N149
MassIVEiQ8N149
PaxDbiQ8N149
PeptideAtlasiQ8N149
PRIDEiQ8N149
ProteomicsDBi71558 [Q8N149-1]
71559 [Q8N149-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34828, 317 antibodies

The DNASU plasmid repository

More...
DNASUi
11027

Genome annotation databases

EnsembliENST00000251376; ENSP00000251376; ENSG00000239998
ENST00000251377; ENSP00000251377; ENSG00000239998
ENST00000391738; ENSP00000375618; ENSG00000239998
ENST00000611940; ENSP00000478981; ENSG00000275290 [Q8N149-1]
ENST00000613573; ENSP00000479743; ENSG00000275290 [Q8N149-2]
ENST00000616629; ENSP00000481338; ENSG00000275290 [Q8N149-1]
ENST00000617409; ENSP00000479914; ENSG00000274000 [Q8N149-1]
ENST00000620279; ENSP00000480939; ENSG00000274000 [Q8N149-2]
ENST00000621721; ENSP00000484762; ENSG00000278634 [Q8N149-2]
ENST00000622640; ENSP00000483906; ENSG00000278634 [Q8N149-1]
GeneIDi11027
KEGGihsa:11027
UCSCiuc002qgf.5, human [Q8N149-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11027
DisGeNETi11027
EuPathDBiHostDB:ENSG00000239998.5

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LILRA2
HGNCiHGNC:6603, LILRA2
HPAiENSG00000239998, Group enriched (blood, bone marrow, lymphoid tissue)
MIMi604812, gene
neXtProtiNX_Q8N149
PharmGKBiPA30377

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RYEX, Eukaryota
HOGENOMiCLU_021100_2_0_1
InParanoidiQ8N149
KOiK06512
OrthoDBi1000446at2759
PhylomeDBiQ8N149
TreeFamiTF336644

Enzyme and pathway databases

PathwayCommonsiQ8N149
ReactomeiR-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
11027, 2 hits in 860 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LILRA2, human
EvolutionaryTraceiQ8N149

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LILRA2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11027
PharosiQ8N149, Tbio

Protein Ontology

More...
PROi
PR:Q8N149
RNActiQ8N149, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000239998, Expressed in blood and 182 other tissues
ExpressionAtlasiQ8N149, baseline and differential
GenevisibleiQ8N149, HS

Family and domain databases

Gene3Di2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR016332, A1B_glyco/leuk_Ig-like_rcpt
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR013151, Immunoglobulin
PfamiView protein in Pfam
PF00047, ig, 1 hit
PF13895, Ig_2, 1 hit
PIRSFiPIRSF001979, Alpha_1B_glycoprot_prd, 1 hit
SMARTiView protein in SMART
SM00409, IG, 4 hits
SM00408, IGc2, 3 hits
SUPFAMiSSF48726, SSF48726, 4 hits
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIRA2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N149
Secondary accession number(s): O75020
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: October 3, 2003
Last modified: August 12, 2020
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again