Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell adhesion molecule 3

Gene

CADM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the cell-cell adhesion. Has both calcium-independent homophilic cell-cell adhesion activity and calcium-independent heterophilic cell-cell adhesion activity with IGSF4, NECTIN1 and NECTIN3. Interaction with EPB41L1 may regulate structure or function of cell-cell junctions (By similarity).By similarity

GO - Molecular functioni

  • cell adhesion molecule binding Source: GO_Central
  • protein homodimerization activity Source: HGNC
  • signaling receptor binding Source: GO_Central

GO - Biological processi

Keywordsi

Biological processCell adhesion
LigandCalcium

Enzyme and pathway databases

ReactomeiR-HSA-418990 Adherens junctions interactions
R-HSA-420597 Nectin/Necl trans heterodimerization

Names & Taxonomyi

Protein namesi
Recommended name:
Cell adhesion molecule 3
Alternative name(s):
Brain immunoglobulin receptor
Immunoglobulin superfamily member 4B
Short name:
IgSF4B
Nectin-like protein 1
Short name:
NECL-1
Synaptic cell adhesion molecule 3
Short name:
SynCAM3
TSLC1-like protein 1
Short name:
TSLL1
Gene namesi
Name:CADM3
Synonyms:IGSF4B, NECL1, SYNCAM3, TSLL1
ORF Names:UNQ225/PRO258
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000162706.12
HGNCiHGNC:17601 CADM3
MIMi609743 gene
neXtProtiNX_Q8N126

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini25 – 330ExtracellularSequence analysisAdd BLAST306
Transmembranei331 – 351HelicalSequence analysisAdd BLAST21
Topological domaini352 – 398CytoplasmicSequence analysisAdd BLAST47

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi57863
OpenTargetsiENSG00000162706
PharmGKBiPA162380906

Polymorphism and mutation databases

BioMutaiCADM3
DMDMi74759761

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 241 PublicationAdd BLAST24
ChainiPRO_000004606725 – 398Cell adhesion molecule 3Add BLAST374

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi50 ↔ 110PROSITE-ProRule annotation1 Publication
Disulfide bondi152 ↔ 209PROSITE-ProRule annotation
Disulfide bondi254 ↔ 299PROSITE-ProRule annotation
Glycosylationi290N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei388PhosphoserineBy similarity1

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei25Not glycosylated1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ8N126
MaxQBiQ8N126
PeptideAtlasiQ8N126
PRIDEiQ8N126
ProteomicsDBi71524
71525 [Q8N126-2]
71526 [Q8N126-3]

PTM databases

iPTMnetiQ8N126
PhosphoSitePlusiQ8N126

Expressioni

Tissue specificityi

Isoform 1 is expressed mainly in adult and fetal brain. Isoform 2 is highly expressed in adult brain and weakly expressed in placenta. In brain, Isoform 2 is highly expressed in cerebellum.3 Publications

Inductioni

Markedly in glioma cell lines and prostate cancer cell lines.1 Publication

Gene expression databases

BgeeiENSG00000162706
CleanExiHS_CADM3
ExpressionAtlasiQ8N126 baseline and differential
GenevisibleiQ8N126 HS

Organism-specific databases

HPAiCAB025746
HPA002981

Interactioni

Subunit structurei

Homodimer. Can form trans-heterodimers with NECTIN3. Interacts with EPB41L1, DLG3, MPP6 and CASK (By similarity).By similarity

GO - Molecular functioni

  • cell adhesion molecule binding Source: GO_Central
  • protein homodimerization activity Source: HGNC
  • signaling receptor binding Source: GO_Central

Protein-protein interaction databases

IntActiQ8N126, 1 interactor

Structurei

Secondary structure

1398
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi38 – 41Combined sources4
Beta strandi46 – 51Combined sources6
Beta strandi60 – 63Combined sources4
Beta strandi69 – 72Combined sources4
Beta strandi83 – 88Combined sources6
Beta strandi90 – 97Combined sources8
Helixi102 – 104Combined sources3
Beta strandi106 – 112Combined sources7
Beta strandi114 – 116Combined sources3
Beta strandi118 – 127Combined sources10

3D structure databases

ProteinModelPortaliQ8N126
SMRiQ8N126
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8N126

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 126Ig-like V-typeAdd BLAST102
Domaini130 – 228Ig-like C2-type 1Add BLAST99
Domaini233 – 315Ig-like C2-type 2Add BLAST83

Domaini

The cytoplasmic region mediates interaction with EPB41L1, DLG3, MPP6 and CASK.By similarity

Sequence similaritiesi

Belongs to the nectin family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00900000140811
HOGENOMiHOG000036057
HOVERGENiHBG057086
InParanoidiQ8N126
KOiK06780
OMAiAAQLTWR
OrthoDBiEOG091G0BHE
PhylomeDBiQ8N126
TreeFamiTF326804

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR013162 CD80_C2-set
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR003585 Neurexin-like
PfamiView protein in Pfam
PF08205 C2-set_2, 1 hit
PF07679 I-set, 1 hit
SMARTiView protein in SMART
SM00294 4.1m, 1 hit
SM00409 IG, 3 hits
SM00408 IGc2, 3 hits
SUPFAMiSSF48726 SSF48726, 3 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 3 hits

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N126-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAPAASLLL LLLLFACCWA PGGANLSQDD SQPWTSDETV VAGGTVVLKC
60 70 80 90 100
QVKDHEDSSL QWSNPAQQTL YFGEKRALRD NRIQLVTSTP HELSISISNV
110 120 130 140 150
ALADEGEYTC SIFTMPVRTA KSLVTVLGIP QKPIITGYKS SLREKDTATL
160 170 180 190 200
NCQSSGSKPA ARLTWRKGDQ ELHGEPTRIQ EDPNGKTFTV SSSVTFQVTR
210 220 230 240 250
EDDGASIVCS VNHESLKGAD RSTSQRIEVL YTPTAMIRPD PPHPREGQKL
260 270 280 290 300
LLHCEGRGNP VPQQYLWEKE GSVPPLKMTQ ESALIFPFLN KSDSGTYGCT
310 320 330 340 350
ATSNMGSYKA YYTLNVNDPS PVPSSSSTYH AIIGGIVAFI VFLLLIMLIF
360 370 380 390
LGHYLIRHKG TYLTHEAKGS DDAPDADTAI INAEGGQSGG DDKKEYFI
Length:398
Mass (Da):43,300
Last modified:October 1, 2002 - v1
Checksum:i601B2FB5D512DB6C
GO
Isoform 2 (identifier: Q8N126-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-29: D → DGYWQEQDLELGTLAPLDEAISSTVWSSPDMLASQ

Show »
Length:432
Mass (Da):47,021
Checksum:iAC474EFECC4C518C
GO
Isoform 3 (identifier: Q8N126-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-231: GKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLY → D

Show »
Length:352
Mass (Da):38,326
Checksum:i74F2F5CD5FDB353D
GO

Sequence cautioni

The sequence BAA91756 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059383162R → W. Corresponds to variant dbSNP:rs3026987Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01722129D → DGYWQEQDLELGTLAPLDEA ISSTVWSSPDMLASQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_022008185 – 231GKTFT…IEVLY → D in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF363367 mRNA Translation: AAM60749.1
AF062733 mRNA Translation: AAD17540.2
AY046418 mRNA Translation: AAL02143.1
AY358332 mRNA Translation: AAQ88698.1
AL035403 Genomic DNA No translation available.
AF529206 mRNA Translation: AAN75603.1
AK001560 mRNA Translation: BAA91756.1 Different initiation.
CCDSiCCDS1182.1 [Q8N126-2]
CCDS44251.1 [Q8N126-1]
RefSeqiNP_001120645.1, NM_001127173.2 [Q8N126-1]
NP_001333439.1, NM_001346510.1 [Q8N126-3]
NP_067012.1, NM_021189.4 [Q8N126-2]
UniGeneiHs.365689

Genome annotation databases

EnsembliENST00000368124; ENSP00000357106; ENSG00000162706 [Q8N126-2]
ENST00000368125; ENSP00000357107; ENSG00000162706 [Q8N126-1]
GeneIDi57863
KEGGihsa:57863
UCSCiuc001ftk.3 human [Q8N126-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCADM3_HUMAN
AccessioniPrimary (citable) accession number: Q8N126
Secondary accession number(s): Q8IZQ9, Q9NVJ5, Q9UJP1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: October 1, 2002
Last modified: July 18, 2018
This is version 148 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health