Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 157 (18 Sep 2019)
Sequence version 2 (21 Mar 2012)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Mesoderm induction early response protein 1

Gene

MIER1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mesoderm induction early response protein 1
Short name:
Early response 1
Short name:
Er1
Short name:
Mi-er1
Short name:
hMi-er1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MIER1
Synonyms:KIAA1610
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29657 MIER1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N108

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi214W → A: Loss of transcriptional repression and HDAC1 recruitment activity. 1 Publication1
Mutagenesisi227 – 228FL → AA: Loss of transcriptional repression and HDAC1 recruitment activity. 1 Publication2

Organism-specific databases

DisGeNET

More...
DisGeNETi
57708

Open Targets

More...
OpenTargetsi
ENSG00000198160

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671456

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MIER1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
380865399

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001971411 – 512Mesoderm induction early response protein 1Add BLAST512

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei10PhosphoserineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Modified residuei155PhosphotyrosineCombined sources1
Modified residuei160PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki239Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei367PhosphoserineCombined sources1
Modified residuei369PhosphoserineCombined sources1
Modified residuei377PhosphoserineCombined sources1
Cross-linki420Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei448PhosphothreonineCombined sources1
Modified residuei483PhosphoserineCombined sources1
Modified residuei488PhosphoserineCombined sources1
Modified residuei491PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N108

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N108

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N108

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N108

PeptideAtlas

More...
PeptideAtlasi
Q8N108

PRoteomics IDEntifications database

More...
PRIDEi
Q8N108

ProteomicsDB human proteome resource

More...
ProteomicsDBi
58657
64844
71504 [Q8N108-11]
71505 [Q8N108-12]
71506 [Q8N108-13]
71507 [Q8N108-14]
71508 [Q8N108-15]
71509 [Q8N108-16]
71510 [Q8N108-17]
71511 [Q8N108-18]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N108

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N108

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, but at very low levels. However, consistent level of expression are observed in heart, testis, thyroid, ovary and adrenal gland. Transcripts are up-regulated in breast carcinoma cell lines and tumor.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198160 Expressed in 210 organ(s), highest expression level in intestine

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N108 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019589
HPA050306

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HDAC1.

Part of a complex containing at least CDYL, MIER1, MIER2, HDAC1 and HDAC2.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121732, 37 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N108, 26 interactors

Molecular INTeraction database

More...
MINTi
Q8N108

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000383820

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N108

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini180 – 278ELM2PROSITE-ProRule annotationAdd BLAST99
Domaini283 – 335SANTPROSITE-ProRule annotationAdd BLAST53

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni180 – 284Interaction with HDAC11 PublicationAdd BLAST105

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi36 – 181Glu-richAdd BLAST146

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4329 Eukaryota
ENOG410Y9DJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182752

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015798

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N108

Identification of Orthologs from Complete Genome Data

More...
OMAi
DCELFER

Database of Orthologous Groups

More...
OrthoDBi
1062529at2759

TreeFam database of animal gene trees

More...
TreeFami
TF106453

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR040138 MIER/MTA
IPR031169 MIER1
IPR001005 SANT/Myb
IPR017884 SANT_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10865 PTHR10865, 1 hit
PTHR10865:SF24 PTHR10865:SF24, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01448 ELM2, 1 hit
PF00249 Myb_DNA-binding, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01189 ELM2, 1 hit
SM00717 SANT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51156 ELM2, 1 hit
PS51293 SANT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8N108-11) [UniParc]FASTAAdd to basket
Also known as: N3-beta

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEPSVESSS PGGSATSDDH EFDPSADMLV HDFDDERTLE EEEMMEGETN
60 70 80 90 100
FSSEIEDLAR EGDMPIHELL SLYGYGSTVR LPEEDEEEEE EEEEGEDDED
110 120 130 140 150
ADNDDNSGCS GENKEENIKD SSGQEDETQS SNDDPSQSVA SQDAQEIIRP
160 170 180 190 200
RRCKYFDTNS EVEEESEEDE DYIPSEDWKK EIMVGSMFQA EIPVGICRYK
210 220 230 240 250
ENEKVYENDD QLLWDPEYLP EDKVIIFLKD ASRRTGDEKG VEAIPEGSHI
260 270 280 290 300
KDNEQALYEL VKCNFDTEEA LRRLRFNVKA AREELSVWTE EECRNFEQGL
310 320 330 340 350
KAYGKDFHLI QANKVRTRSV GECVAFYYMW KKSERYDFFA QQTRFGKKKY
360 370 380 390 400
NLHPGVTDYM DRLLDESESA ASSRAPSPPP TASNSSNSQS EKEDGTVSTA
410 420 430 440 450
NQNGVSSNGP GEILNKEEVK VEGLHINGPT GGNKKPLHAD MDTNGYETDN
460 470 480 490 500
LTTDPKLAHM TARNENDFDE KSERPAKRRR VNSNGKESPG SSEFFQEAVS
510
HGKFEELENT DD
Length:512
Mass (Da):57,983
Last modified:March 21, 2012 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i182C92C7FC5063AD
GO
Isoform 2 (identifier: Q8N108-12) [UniParc]FASTAAdd to basket
Also known as: N2-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MDGASSGGGGSSEGGGGSSGSGYGVVARFSQCLAEFRTWLRTNWLRFNADKTDVML

Note: It is uncertain whether Met-1 or Met-55 is the initiator.Curated
Show »
Length:565
Mass (Da):63,426
Checksum:i16185DC567BFE39A
GO
Isoform 3 (identifier: Q8N108-13) [UniParc]FASTAAdd to basket
Also known as: N1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ

Show »
Length:529
Mass (Da):60,242
Checksum:iD8F1B4A1670CCB50
GO
Isoform 4 (identifier: Q8N108-14) [UniParc]FASTAAdd to basket
Also known as: N1-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ
     412-433: EILNKEEVKVEGLHINGPTGGN → ILQMLLPVHFSAISSRANAFLK
     434-512: Missing.

Show »
Length:450
Mass (Da):51,357
Checksum:iB339B7E0000983DB
GO
Isoform 5 (identifier: Q8N108-15) [UniParc]FASTAAdd to basket
Also known as: N2-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MDGASSGGGGSSEGGGGSSGSGYGVVARFSQCLAEFRTWLRTNWLRFNADKTDVML
     412-433: EILNKEEVKVEGLHINGPTGGN → ILQMLLPVHFSAISSRANAFLK
     434-512: Missing.

Note: It is uncertain whether Met-1 or Met-55 is the initiator.Curated
Show »
Length:486
Mass (Da):54,541
Checksum:i8D36479DEC980333
GO
Isoform 6 (identifier: Q8N108-16) [UniParc]FASTAAdd to basket
Also known as: N3-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     412-433: EILNKEEVKVEGLHINGPTGGN → ILQMLLPVHFSAISSRANAFLK
     434-512: Missing.

Show »
Length:433
Mass (Da):49,098
Checksum:i9750760C605BDBE5
GO
Isoform 7 (identifier: Q8N108-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: Missing.

Note: No experimental confirmation available.
Show »
Length:485
Mass (Da):55,292
Checksum:iCC3F2EB3F7A9E6CD
GO
Isoform 8 (identifier: Q8N108-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ
     432-512: GNKKPLHADM...KFEELENTDD → ILQMLLPVHFSAISSRANAFLK

Show »
Length:470
Mass (Da):53,515
Checksum:i5FE1BD4941041D64
GO
Isoform 9 (identifier: Q8N108-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.
     412-512: EILNKEEVKV...KFEELENTDD → ILQMLLPVHFSAISSRANAFLK

Show »
Length:370
Mass (Da):42,175
Checksum:i9651C040068C7B86
GO
Isoform 10 (identifier: Q8N108-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MAE → MFMFNWFTDCLWTLFLSNYQ
     61-64: EGDM → VNNM
     65-512: Missing.

Show »
Length:81
Mass (Da):9,357
Checksum:iEFDE957922641076
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH17423 differs from that shown. Wrong choice of CDS. Probable cloning artifact due to reverse transcription from RNA internal poly-A tracts.Curated
The sequence AAM76041 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAM97500 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAM97503 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAM97506 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC11339 differs from that shown. Chimeric cDNA. C-terminal is identical to the product of the WLS gene.Curated
The sequence CAD89921 differs from that shown. Wrong choice of CDS.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14S → P in BC066898 (PubMed:15489334).Curated1
Sequence conflicti142Q → H in CAH10526 (PubMed:17974005).Curated1
Sequence conflicti156F → S in BAC11339 (PubMed:14702039).Curated1
Sequence conflicti237D → G in CAH10526 (PubMed:17974005).Curated1
Isoform 2 (identifier: Q8N108-12)
Sequence conflicti1M → L in AAM76041 (PubMed:12242014).Curated1
Sequence conflicti1M → L in AAM97503 (PubMed:12242014).Curated1
Sequence conflicti1M → L in AAM97506 (PubMed:12242014).Curated1
Isoform 5 (identifier: Q8N108-15)
Sequence conflicti1M → L in AAM97500 (PubMed:12242014).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0443431 – 63Missing in isoform 9. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0424491 – 27Missing in isoform 7. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_0424501 – 3MAE → MDGASSGGGGSSEGGGGSSG SGYGVVARFSQCLAEFRTWL RTNWLRFNADKTDVML in isoform 2 and isoform 5. 2 Publications3
Alternative sequenceiVSP_0424511 – 3MAE → MFMFNWFTDCLWTLFLSNYQ in isoform 3, isoform 4, isoform 8 and isoform 10. 3 Publications3
Alternative sequenceiVSP_05571061 – 64EGDM → VNNM in isoform 10. 1 Publication4
Alternative sequenceiVSP_05571165 – 512Missing in isoform 10. 1 PublicationAdd BLAST448
Alternative sequenceiVSP_044344412 – 512EILNK…ENTDD → ILQMLLPVHFSAISSRANAF LK in isoform 9. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_042452412 – 433EILNK…PTGGN → ILQMLLPVHFSAISSRANAF LK in isoform 4, isoform 5 and isoform 6. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_043218432 – 512GNKKP…ENTDD → ILQMLLPVHFSAISSRANAF LK in isoform 8. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_042453434 – 512Missing in isoform 4, isoform 5 and isoform 6. 1 PublicationAdd BLAST79

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF515446 mRNA Translation: AAM76040.1
AF515447 mRNA Translation: AAM76041.1 Different initiation.
AF515448 mRNA Translation: AAM76042.2
AY124186 mRNA Translation: AAM97499.2
AY124187 mRNA Translation: AAM97500.1 Different initiation.
AY124188 mRNA Translation: AAM97501.1
AY124189 mRNA Translation: AAM97502.2
AY124190 mRNA Translation: AAM97503.1 Different initiation.
AY124191 mRNA Translation: AAM97504.1
AY124192 mRNA Translation: AAM97505.2
AY124193 mRNA Translation: AAM97506.1 Different initiation.
AY124194 mRNA Translation: AAM97507.1
AK074990 mRNA Translation: BAC11339.1 Sequence problems.
AK302061 mRNA Translation: BAG63451.1
AL831987 mRNA Translation: CAD89921.1 Sequence problems.
CR627441 mRNA Translation: CAH10526.1
AL139216 Genomic DNA No translation available.
AL500525 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06505.1
CH471059 Genomic DNA Translation: EAX06508.1
BC017423 mRNA Translation: AAH17423.1 Sequence problems.
BC066898 mRNA No translation available.
BC108726 mRNA Translation: AAI08727.1
BC125217 mRNA Translation: AAI25218.1
BC125218 mRNA Translation: AAI25219.1
AB046830 mRNA Translation: BAB13436.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41347.1 [Q8N108-16]
CCDS41348.1 [Q8N108-11]
CCDS53325.1 [Q8N108-15]
CCDS53326.1 [Q8N108-12]
CCDS53327.1 [Q8N108-14]
CCDS53328.1 [Q8N108-18]
CCDS53329.1 [Q8N108-13]
CCDS53330.1 [Q8N108-19]
CCDS60163.1 [Q8N108-20]

NCBI Reference Sequences

More...
RefSeqi
NP_001071168.2, NM_001077700.2 [Q8N108-12]
NP_001071169.1, NM_001077701.2 [Q8N108-11]
NP_001071170.2, NM_001077702.2 [Q8N108-14]
NP_001071171.2, NM_001077703.2 [Q8N108-15]
NP_001071172.1, NM_001077704.2 [Q8N108-16]
NP_001139582.1, NM_001146110.1 [Q8N108-13]
NP_001139583.1, NM_001146111.1 [Q8N108-18]
NP_001139584.1, NM_001146112.1 [Q8N108-17]
NP_001139585.1, NM_001146113.1 [Q8N108-19]
NP_001265144.1, NM_001278215.1 [Q8N108-20]
NP_065999.2, NM_020948.3 [Q8N108-13]
XP_005271133.1, XM_005271076.3 [Q8N108-13]
XP_016857413.1, XM_017001924.1 [Q8N108-13]
XP_016857414.1, XM_017001925.1 [Q8N108-13]
XP_016857415.1, XM_017001926.1 [Q8N108-13]
XP_016857416.1, XM_017001927.1
XP_016857417.1, XM_017001928.1
XP_016857420.1, XM_017001931.1 [Q8N108-17]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000355356; ENSP00000347514; ENSG00000198160 [Q8N108-11]
ENST00000355977; ENSP00000348253; ENSG00000198160 [Q8N108-19]
ENST00000357692; ENSP00000350321; ENSG00000198160 [Q8N108-13]
ENST00000371012; ENSP00000360051; ENSG00000198160 [Q8N108-20]
ENST00000371014; ENSP00000360053; ENSG00000198160 [Q8N108-15]
ENST00000371016; ENSP00000360055; ENSG00000198160 [Q8N108-14]
ENST00000371018; ENSP00000360057; ENSG00000198160 [Q8N108-18]
ENST00000401041; ENSP00000383820; ENSG00000198160 [Q8N108-12]
ENST00000401042; ENSP00000383821; ENSG00000198160 [Q8N108-16]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57708

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57708

UCSC genome browser

More...
UCSCi
uc001dda.6 human [Q8N108-11]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF515446 mRNA Translation: AAM76040.1
AF515447 mRNA Translation: AAM76041.1 Different initiation.
AF515448 mRNA Translation: AAM76042.2
AY124186 mRNA Translation: AAM97499.2
AY124187 mRNA Translation: AAM97500.1 Different initiation.
AY124188 mRNA Translation: AAM97501.1
AY124189 mRNA Translation: AAM97502.2
AY124190 mRNA Translation: AAM97503.1 Different initiation.
AY124191 mRNA Translation: AAM97504.1
AY124192 mRNA Translation: AAM97505.2
AY124193 mRNA Translation: AAM97506.1 Different initiation.
AY124194 mRNA Translation: AAM97507.1
AK074990 mRNA Translation: BAC11339.1 Sequence problems.
AK302061 mRNA Translation: BAG63451.1
AL831987 mRNA Translation: CAD89921.1 Sequence problems.
CR627441 mRNA Translation: CAH10526.1
AL139216 Genomic DNA No translation available.
AL500525 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06505.1
CH471059 Genomic DNA Translation: EAX06508.1
BC017423 mRNA Translation: AAH17423.1 Sequence problems.
BC066898 mRNA No translation available.
BC108726 mRNA Translation: AAI08727.1
BC125217 mRNA Translation: AAI25218.1
BC125218 mRNA Translation: AAI25219.1
AB046830 mRNA Translation: BAB13436.1
CCDSiCCDS41347.1 [Q8N108-16]
CCDS41348.1 [Q8N108-11]
CCDS53325.1 [Q8N108-15]
CCDS53326.1 [Q8N108-12]
CCDS53327.1 [Q8N108-14]
CCDS53328.1 [Q8N108-18]
CCDS53329.1 [Q8N108-13]
CCDS53330.1 [Q8N108-19]
CCDS60163.1 [Q8N108-20]
RefSeqiNP_001071168.2, NM_001077700.2 [Q8N108-12]
NP_001071169.1, NM_001077701.2 [Q8N108-11]
NP_001071170.2, NM_001077702.2 [Q8N108-14]
NP_001071171.2, NM_001077703.2 [Q8N108-15]
NP_001071172.1, NM_001077704.2 [Q8N108-16]
NP_001139582.1, NM_001146110.1 [Q8N108-13]
NP_001139583.1, NM_001146111.1 [Q8N108-18]
NP_001139584.1, NM_001146112.1 [Q8N108-17]
NP_001139585.1, NM_001146113.1 [Q8N108-19]
NP_001265144.1, NM_001278215.1 [Q8N108-20]
NP_065999.2, NM_020948.3 [Q8N108-13]
XP_005271133.1, XM_005271076.3 [Q8N108-13]
XP_016857413.1, XM_017001924.1 [Q8N108-13]
XP_016857414.1, XM_017001925.1 [Q8N108-13]
XP_016857415.1, XM_017001926.1 [Q8N108-13]
XP_016857416.1, XM_017001927.1
XP_016857417.1, XM_017001928.1
XP_016857420.1, XM_017001931.1 [Q8N108-17]

3D structure databases

SMRiQ8N108
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121732, 37 interactors
IntActiQ8N108, 26 interactors
MINTiQ8N108
STRINGi9606.ENSP00000383820

PTM databases

iPTMnetiQ8N108
PhosphoSitePlusiQ8N108

Polymorphism and mutation databases

BioMutaiMIER1
DMDMi380865399

Proteomic databases

EPDiQ8N108
jPOSTiQ8N108
MassIVEiQ8N108
PaxDbiQ8N108
PeptideAtlasiQ8N108
PRIDEiQ8N108
ProteomicsDBi58657
64844
71504 [Q8N108-11]
71505 [Q8N108-12]
71506 [Q8N108-13]
71507 [Q8N108-14]
71508 [Q8N108-15]
71509 [Q8N108-16]
71510 [Q8N108-17]
71511 [Q8N108-18]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355356; ENSP00000347514; ENSG00000198160 [Q8N108-11]
ENST00000355977; ENSP00000348253; ENSG00000198160 [Q8N108-19]
ENST00000357692; ENSP00000350321; ENSG00000198160 [Q8N108-13]
ENST00000371012; ENSP00000360051; ENSG00000198160 [Q8N108-20]
ENST00000371014; ENSP00000360053; ENSG00000198160 [Q8N108-15]
ENST00000371016; ENSP00000360055; ENSG00000198160 [Q8N108-14]
ENST00000371018; ENSP00000360057; ENSG00000198160 [Q8N108-18]
ENST00000401041; ENSP00000383820; ENSG00000198160 [Q8N108-12]
ENST00000401042; ENSP00000383821; ENSG00000198160 [Q8N108-16]
GeneIDi57708
KEGGihsa:57708
UCSCiuc001dda.6 human [Q8N108-11]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57708
DisGeNETi57708

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MIER1
HGNCiHGNC:29657 MIER1
HPAiHPA019589
HPA050306
neXtProtiNX_Q8N108
OpenTargetsiENSG00000198160
PharmGKBiPA142671456

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4329 Eukaryota
ENOG410Y9DJ LUCA
GeneTreeiENSGT00950000182752
HOGENOMiHOG000015798
InParanoidiQ8N108
OMAiDCELFER
OrthoDBi1062529at2759
TreeFamiTF106453

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MIER1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MIER1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57708

Pharos

More...
Pharosi
Q8N108

Protein Ontology

More...
PROi
PR:Q8N108

Gene expression databases

BgeeiENSG00000198160 Expressed in 210 organ(s), highest expression level in intestine
GenevisibleiQ8N108 HS

Family and domain databases

InterProiView protein in InterPro
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR040138 MIER/MTA
IPR031169 MIER1
IPR001005 SANT/Myb
IPR017884 SANT_dom
PANTHERiPTHR10865 PTHR10865, 1 hit
PTHR10865:SF24 PTHR10865:SF24, 1 hit
PfamiView protein in Pfam
PF01448 ELM2, 1 hit
PF00249 Myb_DNA-binding, 1 hit
SMARTiView protein in SMART
SM01189 ELM2, 1 hit
SM00717 SANT, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
PROSITEiView protein in PROSITE
PS51156 ELM2, 1 hit
PS51293 SANT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMIER1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N108
Secondary accession number(s): C9JFD4
, Q08AE0, Q32NC4, Q5T104, Q5TAD1, Q5TAD2, Q5TAD4, Q5TAD5, Q6AHY8, Q86TB4, Q8N156, Q8N161, Q8NC37, Q8NES4, Q8NES5, Q8NES6, Q8WWG2, Q9HCG2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: March 21, 2012
Last modified: September 18, 2019
This is version 157 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again