Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (16 Oct 2019)
Sequence version 2 (06 Mar 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sperm-associated antigen 16 protein

Gene

SPAG16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8N0X2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sperm-associated antigen 16 protein
Alternative name(s):
Pf20 protein homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPAG16
Synonyms:PF20
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23225 SPAG16

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612173 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N0X2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Flagellum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79582

Open Targets

More...
OpenTargetsi
ENSG00000144451

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134887898

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N0X2

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPAG16

Domain mapping of disease mutations (DMDM)

More...
DMDMi
146329993

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000512231 – 631Sperm-associated antigen 16 proteinAdd BLAST631

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by TSSK2.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N0X2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N0X2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N0X2

PeptideAtlas

More...
PeptideAtlasi
Q8N0X2

PRoteomics IDEntifications database

More...
PRIDEi
Q8N0X2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
71478 [Q8N0X2-1]
71479 [Q8N0X2-2]
71480 [Q8N0X2-3]
71481 [Q8N0X2-4]
71482 [Q8N0X2-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N0X2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N0X2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is detected in testis. Isoform 4 is detected in testis and brain, and at lower levels in kidney, heart, pancreas, thyroid, ovary, adrenal gland, spinal cord, trachea and liver.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000144451 Expressed in 228 organ(s), highest expression level in bronchial epithelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N0X2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N0X2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037542

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SPAG6 and STK36.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122726, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N0X2, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000332592

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N0X2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati350 – 389WD 1Add BLAST40
Repeati392 – 431WD 2Add BLAST40
Repeati434 – 473WD 3Add BLAST40
Repeati476 – 515WD 4Add BLAST40
Repeati518 – 557WD 5Add BLAST40
Repeati560 – 600WD 6Add BLAST41
Repeati601 – 630WD 7Add BLAST30

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili152 – 267Sequence analysisAdd BLAST116

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410INWU Eukaryota
ENOG410XRA2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155053

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N0X2

Identification of Orthologs from Complete Genome Data

More...
OMAi
GTWDKFR

Database of Orthologous Groups

More...
OrthoDBi
1144264at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N0X2

TreeFam database of animal gene trees

More...
TreeFami
TF351566

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00400 WD40, 5 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00320 GPROTEINBRPT

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 3 hits
PS50082 WD_REPEATS_2, 5 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N0X2-1) [UniParc]FASTAAdd to basket
Also known as: PF20 variant 1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAQRGMPSS AVRVLEEALG MGLTAAGDAR DTADAVAAEG AYYLEQVTIT
60 70 80 90 100
EASEDDYEYE EIPDDNFSIP EGEEDLAKAI QMAQEQATDT EILERKTVLP
110 120 130 140 150
SKHAVPEVIE DFLCNFLIKM GMTRTLDCFQ SEWYELIQKG VTELRTVGNV
160 170 180 190 200
PDVYTQIMLL ENENKNLKKD LKHYKQAADK AREDLLKIQK ERDFHRMHHK
210 220 230 240 250
RIVQEKNKLI NDLKGLKLHY ASYEPTIRVL HEKHHTLLKE KMLTSLERDK
260 270 280 290 300
VVGQISGLQE TLKKLQRGHS YHGPQIKVDH SREKENAPEG PTQKGLREAR
310 320 330 340 350
EQNKCKTKMK GNTKDSEFPI DMQPNPNLNV SKESLSPAKF DYKLKNIFRL
360 370 380 390 400
HELPVSCVSM QPHKDILVSC GEDRLWKVLG LPKCNVLLTG FGHTDWLSDC
410 420 430 440 450
CFHPSGDKLA TSSGDTTVKL WDLCKGDCIL TFEGHSRAVW SCTWHSCGNF
460 470 480 490 500
VASSSLDKTS KIWDVNSERC RCTLYGHTDS VNSIEFFPFS NTLLTSSADK
510 520 530 540 550
TLSIWDARTG ICEQSLYGHM HSINDAIFDP RGHMIASCDA CGVTKLWDFR
560 570 580 590 600
KLLPIVSIDI GPSPGNEVNF DSSGRVLAQA SGNGVIHLLD LKSGEIHKLM
610 620 630
GHENEAHTVV FSHDGEILFS GGSDGTVRTW S
Length:631
Mass (Da):70,818
Last modified:March 6, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9722B49AC8FFA31C
GO
Isoform 2 (identifier: Q8N0X2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-149: Missing.
     150-179: VPDVYTQIMLLENENKNLKKDLKHYKQAAD → MTILASQKVKKIWQKQFRWPKNRLQILKFC
     574-631: GRVLAQASGN...GSDGTVRTWS → ENTTYLYRPGAQIYYFQLS

Note: No experimental confirmation available.
Show »
Length:443
Mass (Da):50,723
Checksum:iFA57EAE062D2673F
GO
Isoform 3 (identifier: Q8N0X2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MAAQRGMPSS...ASEDDYEYEE → MGVGTKARASHWRRLLSLGATPEEPLLDFK
     278-282: VDHSR → GKGCM
     283-631: Missing.

Note: No experimental confirmation available.
Show »
Length:251
Mass (Da):29,043
Checksum:iCA7894259AAC9435
GO
Isoform 4 (identifier: Q8N0X2-4) [UniParc]FASTAAdd to basket
Also known as: PF20 variant 2a

The sequence of this isoform differs from the canonical sequence as follows:
     179-183: DKARE → EYVIF
     184-631: Missing.

Show »
Length:183
Mass (Da):20,552
Checksum:iEB7B529BD49372DE
GO
Isoform 5 (identifier: Q8N0X2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-347: DSEFPIDMQPNPNLNVSKESLSPAKFDYKLKNI → QWTGNSQTWNKTVPLQDTIGRRQENNSAHQHID
     348-631: Missing.

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):39,739
Checksum:i27DEB4C39B9F4CF4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EWV3E7EWV3_HUMAN
Sperm-associated antigen 16 protein
SPAG16
374Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MQX0A0A0A0MQX0_HUMAN
Sperm-associated antigen 16 protein
SPAG16
318Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y811H0Y811_HUMAN
Sperm-associated antigen 16 protein
SPAG16
255Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DG20A0A0C4DG20_HUMAN
Sperm-associated antigen 16 protein
SPAG16
251Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PE90E9PE90_HUMAN
Sperm-associated antigen 16 protein
SPAG16
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WB32F8WB32_HUMAN
Sperm-associated antigen 16 protein
SPAG16
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBQ0F8WBQ0_HUMAN
Sperm-associated antigen 16 protein
SPAG16
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBY1F8WBY1_HUMAN
Sperm-associated antigen 16 protein
SPAG16
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti49I → T in CAG33640 (Ref. 4) Curated1
Sequence conflicti100P → L in CAG33640 (Ref. 4) Curated1
Sequence conflicti173H → Q in CAG33640 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053418324P → T. Corresponds to variant dbSNP:rs10167688Ensembl.1
Natural variantiVAR_022366361Q → H1 PublicationCorresponds to variant dbSNP:rs2042791Ensembl.1
Natural variantiVAR_022367425K → T2 PublicationsCorresponds to variant dbSNP:rs12623569Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0134941 – 149Missing in isoform 2. 1 PublicationAdd BLAST149
Alternative sequenceiVSP_0134931 – 61MAAQR…YEYEE → MGVGTKARASHWRRLLSLGA TPEEPLLDFK in isoform 3. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_013495150 – 179VPDVY…KQAAD → MTILASQKVKKIWQKQFRWP KNRLQILKFC in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_013496179 – 183DKARE → EYVIF in isoform 4. 4 Publications5
Alternative sequenceiVSP_013497184 – 631Missing in isoform 4. 4 PublicationsAdd BLAST448
Alternative sequenceiVSP_013498278 – 282VDHSR → GKGCM in isoform 3. 1 Publication5
Alternative sequenceiVSP_013499283 – 631Missing in isoform 3. 1 PublicationAdd BLAST349
Alternative sequenceiVSP_013500315 – 347DSEFP…KLKNI → QWTGNSQTWNKTVPLQDTIG RRQENNSAHQHID in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_013501348 – 631Missing in isoform 5. 1 PublicationAdd BLAST284
Alternative sequenceiVSP_013502574 – 631GRVLA…VRTWS → ENTTYLYRPGAQIYYFQLS in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF310672 mRNA Translation: AAM63956.1
AF426740 mRNA Translation: AAN63530.1
AF490390 mRNA Translation: AAM97147.1
AK026377 mRNA Translation: BAB15466.1
AK095036 mRNA Translation: BAC04481.1
CR457359 mRNA Translation: CAG33640.1
CR749477 mRNA Translation: CAH18307.1
AL832962 mRNA Translation: CAH56274.1
BC009614 mRNA Translation: AAH09614.1
BC067756 mRNA Translation: AAH67756.1
BC100282 mRNA Translation: AAI00283.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2396.1 [Q8N0X2-1]
CCDS46508.1 [Q8N0X2-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001020607.1, NM_001025436.2 [Q8N0X2-4]
NP_078808.3, NM_024532.4 [Q8N0X2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000331683; ENSP00000332592; ENSG00000144451 [Q8N0X2-1]
ENST00000432529; ENSP00000415079; ENSG00000144451 [Q8N0X2-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79582

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79582

UCSC genome browser

More...
UCSCi
uc002veo.5 human [Q8N0X2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF310672 mRNA Translation: AAM63956.1
AF426740 mRNA Translation: AAN63530.1
AF490390 mRNA Translation: AAM97147.1
AK026377 mRNA Translation: BAB15466.1
AK095036 mRNA Translation: BAC04481.1
CR457359 mRNA Translation: CAG33640.1
CR749477 mRNA Translation: CAH18307.1
AL832962 mRNA Translation: CAH56274.1
BC009614 mRNA Translation: AAH09614.1
BC067756 mRNA Translation: AAH67756.1
BC100282 mRNA Translation: AAI00283.1
CCDSiCCDS2396.1 [Q8N0X2-1]
CCDS46508.1 [Q8N0X2-4]
RefSeqiNP_001020607.1, NM_001025436.2 [Q8N0X2-4]
NP_078808.3, NM_024532.4 [Q8N0X2-1]

3D structure databases

SMRiQ8N0X2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122726, 4 interactors
IntActiQ8N0X2, 7 interactors
STRINGi9606.ENSP00000332592

PTM databases

iPTMnetiQ8N0X2
PhosphoSitePlusiQ8N0X2

Polymorphism and mutation databases

BioMutaiSPAG16
DMDMi146329993

Proteomic databases

jPOSTiQ8N0X2
MassIVEiQ8N0X2
PaxDbiQ8N0X2
PeptideAtlasiQ8N0X2
PRIDEiQ8N0X2
ProteomicsDBi71478 [Q8N0X2-1]
71479 [Q8N0X2-2]
71480 [Q8N0X2-3]
71481 [Q8N0X2-4]
71482 [Q8N0X2-5]

Genome annotation databases

EnsembliENST00000331683; ENSP00000332592; ENSG00000144451 [Q8N0X2-1]
ENST00000432529; ENSP00000415079; ENSG00000144451 [Q8N0X2-4]
GeneIDi79582
KEGGihsa:79582
UCSCiuc002veo.5 human [Q8N0X2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79582
DisGeNETi79582

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPAG16
HGNCiHGNC:23225 SPAG16
HPAiHPA037542
MIMi612173 gene
neXtProtiNX_Q8N0X2
OpenTargetsiENSG00000144451
PharmGKBiPA134887898

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410INWU Eukaryota
ENOG410XRA2 LUCA
GeneTreeiENSGT00940000155053
InParanoidiQ8N0X2
OMAiGTWDKFR
OrthoDBi1144264at2759
PhylomeDBiQ8N0X2
TreeFamiTF351566

Enzyme and pathway databases

SignaLinkiQ8N0X2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPAG16 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79582
PharosiQ8N0X2

Protein Ontology

More...
PROi
PR:Q8N0X2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000144451 Expressed in 228 organ(s), highest expression level in bronchial epithelial cell
ExpressionAtlasiQ8N0X2 baseline and differential
GenevisibleiQ8N0X2 HS

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF00400 WD40, 5 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 3 hits
PS50082 WD_REPEATS_2, 5 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPG16_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N0X2
Secondary accession number(s): Q498B7
, Q658W1, Q68DB3, Q6I9Z6, Q8N9C7, Q9H601
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: March 6, 2007
Last modified: October 16, 2019
This is version 155 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again