Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

IQ domain-containing protein K

Gene

IQCK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
IQ domain-containing protein K
Gene namesi
Name:IQCK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000174628.16
HGNCiHGNC:28556 IQCK
neXtProtiNX_Q8N0W5

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000174628
PharmGKBiPA145148697

Polymorphism and mutation databases

BioMutaiIQCK
DMDMi74728470

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002825741 – 287IQ domain-containing protein KAdd BLAST287

Proteomic databases

PaxDbiQ8N0W5
PeptideAtlasiQ8N0W5
PRIDEiQ8N0W5
ProteomicsDBi71474
71475 [Q8N0W5-2]
71476 [Q8N0W5-3]

PTM databases

iPTMnetiQ8N0W5
PhosphoSitePlusiQ8N0W5

Expressioni

Gene expression databases

BgeeiENSG00000174628
CleanExiHS_IQCK
ExpressionAtlasiQ8N0W5 baseline and differential
GenevisibleiQ8N0W5 HS

Organism-specific databases

HPAiHPA026792
HPA048786

Interactioni

Protein-protein interaction databases

BioGridi125852, 1 interactor
STRINGi9606.ENSP00000324901

Structurei

3D structure databases

ProteinModelPortaliQ8N0W5
SMRiQ8N0W5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IK7E Eukaryota
ENOG4111M9I LUCA
GeneTreeiENSGT00390000007907
HOGENOMiHOG000059665
HOVERGENiHBG104093
InParanoidiQ8N0W5
OMAiREAKHIH
OrthoDBiEOG091G0R7I
PhylomeDBiQ8N0W5
TreeFamiTF336038

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N0W5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPRQIPSH IVRLKPSCST DSSFTRTPVP TVSLASRELP VSSWQVTEPS
60 70 80 90 100
SKNLWEQICK EYEAEQPPFP EGYKVKQEPV ITVAPVEEML FHGFSAEHYF
110 120 130 140 150
PVSHFTMISR TPCPQDKSET INPKTCSPKE YLETFIFPVL LPGMASLLHQ
160 170 180 190 200
AKKEKCFERK RTKFIACDFL TEWLYNQNPK RAGEPFTEFF SIPFVEERLK
210 220 230 240 250
QHPRPPIPLS LLLTEEEAAL YIQSFWRACV VRCDPEIQEL RQWQKKLREA
260 270 280
KHIHQQVKIF WAKQEQKVKC KMEDDAVPAA KMKIPSS
Length:287
Mass (Da):33,292
Last modified:October 1, 2002 - v1
Checksum:iE921F546356BCFD8
GO
Isoform 2 (identifier: Q8N0W5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-189: RKRTKFIACDFLTEWLYNQNPKRAGEPFTEF → PTAANPTLAPADRRGSSPLHSILLESLCGSL
     190-287: Missing.

Show »
Length:189
Mass (Da):21,025
Checksum:i5FAAACB9D1C21BBC
GO
Isoform 3 (identifier: Q8N0W5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     159-209: RKRTKFIACD...KQHPRPPIPL → VSCLAGFLYF...GHLPSSSHTI
     210-287: Missing.

Note: Gene prediction based on EST data. No experimental confirmation available.
Show »
Length:212
Mass (Da):23,800
Checksum:i12C891B7F2704477
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031416220L → P. Corresponds to variant dbSNP:rs7191155Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024204159 – 209RKRTK…PPIPL → VSCLAGFLYFEILNHSLLSD DSSLSWYHQVVLQMTPSGGK ACVWGHLPSSSHTI in isoform 3. CuratedAdd BLAST51
Alternative sequenceiVSP_024205159 – 189RKRTK…PFTEF → PTAANPTLAPADRRGSSPLH SILLESLCGSL in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_024206190 – 287Missing in isoform 2. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_024207210 – 287Missing in isoform 3. CuratedAdd BLAST78

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF520569 mRNA Translation: AAM77339.1
AF520570 mRNA Translation: AAM77340.1
AK315672 mRNA Translation: BAG38037.1
AC002550 Genomic DNA Translation: AAC05807.1
CH471186 Genomic DNA Translation: EAW50300.1
BC034823 mRNA Translation: AAH34823.1
CCDSiCCDS10580.1 [Q8N0W5-1]
RefSeqiNP_001292050.1, NM_001305121.1
NP_001292051.1, NM_001305122.1
NP_694940.1, NM_153208.2 [Q8N0W5-1]
XP_016878422.1, XM_017022933.1 [Q8N0W5-1]
UniGeneiHs.460217
Hs.656664

Genome annotation databases

EnsembliENST00000308214; ENSP00000309261; ENSG00000174628 [Q8N0W5-2]
ENST00000320394; ENSP00000324901; ENSG00000174628 [Q8N0W5-1]
GeneIDi124152
KEGGihsa:124152
UCSCiuc002dgr.4 human [Q8N0W5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiIQCK_HUMAN
AccessioniPrimary (citable) accession number: Q8N0W5
Secondary accession number(s): B2RDU0, O43327, Q8NFF4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2002
Last modified: July 18, 2018
This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health