Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (12 Aug 2020)
Sequence version 2 (30 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

L-fucose kinase

Gene

FCSK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi834 – 845ATPSequence analysisAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.52, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N0W3

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6787639, GDP-fucose biosynthesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
L-fucose kinaseCurated (EC:2.7.1.521 Publication)
Short name:
Fucokinase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FCSKImported
Synonyms:FUKImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000157353.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29500, FCSK

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608675, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N0W3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Congenital disorder of glycosylation with defective fucosylation 2 (CDGF2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of congenital disorder of glycosylation, a genetically heterogeneous group of multisystem disorders caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. CDGF2 is an autosomal recessive disorder, apparent from birth, characterized by hypotonia, poor feeding, severely impaired intellectual and psychomotor development, seizures with epileptic encephalopathy, visual impairment and other ocular features, respiratory difficulty with frequent infections, as well as contractures. Brain imaging shows cerebellar and brainstem atrophy, hypoplasia or agenesis of the corpus callosum, and white matter abnormalities including periventricular leukomalacia.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_081646223S → P in CDGF2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs769009456EnsemblClinVar.1
Natural variantiVAR_081647683R → C in CDGF2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs755169246EnsemblClinVar.1
Natural variantiVAR_081648994K → Q in CDGF2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs199515460EnsemblClinVar.1

Keywords - Diseasei

Congenital disorder of glycosylation, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
197258

MalaCards human disease database

More...
MalaCardsi
FCSK
MIMi618324, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000157353

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134863646

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N0W3, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FUK

Domain mapping of disease mutations (DMDM)

More...
DMDMi
73915340

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001566721 – 1084L-fucose kinaseAdd BLAST1084

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N0W3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N0W3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N0W3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N0W3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N0W3

PeptideAtlas

More...
PeptideAtlasi
Q8N0W3

PRoteomics IDEntifications database

More...
PRIDEi
Q8N0W3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
71470 [Q8N0W3-1]
71471 [Q8N0W3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N0W3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N0W3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in fibroblasts.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157353, Expressed in right hemisphere of cerebellum and 186 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N0W3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N0W3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000157353, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
128243, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N0W3, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000288078

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N0W3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GHMP kinase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4644, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000002251

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006983_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N0W3

KEGG Orthology (KO)

More...
KOi
K05305

Identification of Orthologs from Complete Genome Data

More...
OMAi
EMGQGDM

Database of Orthologous Groups

More...
OrthoDBi
135001at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N0W3

TreeFam database of animal gene trees

More...
TreeFami
TF314554

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012887, Fucokinase
IPR013750, GHMP_kinase_C_dom
IPR036554, GHMP_kinase_C_sf
IPR006204, GHMP_kinase_N_dom
IPR020568, Ribosomal_S5_D2-typ_fold

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07959, Fucokinase, 1 hit
PF08544, GHMP_kinases_C, 1 hit
PF00288, GHMP_kinases_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54211, SSF54211, 1 hit
SSF55060, SSF55060, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N0W3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQPKGVDWT VIILTCQYKD SVQVFQRELE VRQKREQIPA GTLLLAVEDP
60 70 80 90 100
EKRVGSGGAT LNALLVAAEH LSARAGFTVV TSDVLHSAWI LILHMGRDFP
110 120 130 140 150
FDDCGRAFTC LPVENPEAPV EALVCNLDCL LDIMTYRLGP GSPPGVWVCS
160 170 180 190 200
TDMLLSVPAN PGISWDSFRG ARVIALPGSP AYAQNHGVYL TDPQGLVLDI
210 220 230 240 250
YYQGTEAEIQ RCVRPDGRVP LVSGVVFFSV ETAERLLATH VSPPLDACTY
260 270 280 290 300
LGLDSGARPV QLSLFFDILH CMAENVTRED FLVGRPPELG QGDADVAGYL
310 320 330 340 350
QSARAQLWRE LRDQPLTMAY VSSGSYSYMT SSASEFLLSL TLPGAPGAQI
360 370 380 390 400
VHSQVEEQQL LAAGSSVVSC LLEGPVQLGP GSVLQHCHLQ GPIHIGAGCL
410 420 430 440 450
VTGLDTAHSK ALHGRELRDL VLQGHHTRLH GSPGHAFTLV GRLDSWERQG
460 470 480 490 500
AGTYLNVPWS EFFKRTGVRA WDLWDPETLP AEYCLPSARL FPVLHPSREL
510 520 530 540 550
GPQDLLWMLD HQEDGGEALR AWRASWRLSW EQLQPCLDRA ATLASRRDLF
560 570 580 590 600
FRQALHKARH VLEARQDLSL RPLIWAAVRE GCPGPLLATL DQVAAGAGDP
610 620 630 640 650
GVAARALACV ADVLGCMAEG RGGLRSGPAA NPEWMRPFSY LECGDLAAGV
660 670 680 690 700
EALAQERDKW LSRPALLVRA ARHYEGAGQI LIRQAVMSAQ HFVSTEQVEL
710 720 730 740 750
PGPGQWVVAE CPARVDFSGG WSDTPPLAYE LGGAVLGLAV RVDGRRPIGA
760 770 780 790 800
RARRIPEPEL WLAVGPRQDE MTVKIVCRCL ADLRDYCQPH APGALLKAAF
810 820 830 840 850
ICAGIVHVHS ELQLSEQLLR TFGGGFELHT WSELPHGSGL GTSSILAGTA
860 870 880 890 900
LAALQRAAGR VVGTEALIHA VLHLEQVLTT GGGWQDQVGG LMPGIKVGRS
910 920 930 940 950
RAQLPLKVEV EEVTVPEGFV QKLNDHLLLV YTGKTRLARN LLQDVLRSWY
960 970 980 990 1000
ARLPAVVQNA HSLVRQTEEC AEGFRQGSLP LLGQCLTSYW EQKKLMAPGC
1010 1020 1030 1040 1050
EPLTVRRMMD VLAPHVHGQS LAGAGGGGFL YLLTKEPQQK EALEAVLAKT
1060 1070 1080
EGLGNYSIHL VEVDTQGLSL KLLGTEASTC CPFP
Length:1,084
Mass (Da):117,623
Last modified:August 30, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i153F91882F4B143C
GO
Isoform 2 (identifier: Q8N0W3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     78-78: T → TWICVGVSLWIRGCHPPGRLPEASVHRAFPLLQ
     816-841: Missing.

Show »
Length:1,090
Mass (Da):118,393
Checksum:i8522A425A0832887
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KSP6J3KSP6_HUMAN
Fucokinase, isoform CRA_d
FCSK FUK, hCG_1774069
575Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L1X0I3L1X0_HUMAN
L-fucose kinase
FCSK
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTP6J3KTP6_HUMAN
L-fucose kinase
FCSK
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L106I3L106_HUMAN
L-fucose kinase
FCSK
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L171I3L171_HUMAN
L-fucose kinase
FCSK
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L3J1I3L3J1_HUMAN
L-fucose kinase
FCSK
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB71190 differs from that shown. Reason: Frameshift.Curated
The sequence CAD29647 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti400L → S in BAB71190 (PubMed:14702039).Curated1
Sequence conflicti609C → R in BAB71190 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_021327146V → M1 PublicationCorresponds to variant dbSNP:rs17881323Ensembl.1
Natural variantiVAR_081646223S → P in CDGF2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs769009456EnsemblClinVar.1
Natural variantiVAR_021328521A → T1 PublicationCorresponds to variant dbSNP:rs17881069Ensembl.1
Natural variantiVAR_021329571R → H1 PublicationCorresponds to variant dbSNP:rs17886171Ensembl.1
Natural variantiVAR_081647683R → C in CDGF2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs755169246EnsemblClinVar.1
Natural variantiVAR_021330701P → L1 PublicationCorresponds to variant dbSNP:rs17883716Ensembl.1
Natural variantiVAR_021331858A → T1 PublicationCorresponds to variant dbSNP:rs17884050Ensembl.1
Natural variantiVAR_021332861V → M1 PublicationCorresponds to variant dbSNP:rs17878599Ensembl.1
Natural variantiVAR_021333901R → W1 PublicationCorresponds to variant dbSNP:rs17881635Ensembl.1
Natural variantiVAR_021334939R → Q1 PublicationCorresponds to variant dbSNP:rs17886060Ensembl.1
Natural variantiVAR_021335939R → W1 PublicationCorresponds to variant dbSNP:rs17883248Ensembl.1
Natural variantiVAR_081648994K → Q in CDGF2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs199515460EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01542278T → TWICVGVSLWIRGCHPPGRL PEASVHRAFPLLQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_015423816 – 841Missing in isoform 2. 1 PublicationAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ441184 mRNA Translation: CAD29647.1 Frameshift.
AK056456 mRNA Translation: BAB71190.1 Frameshift.
AK128387 mRNA Translation: BAC87413.1
AY829643 Genomic DNA Translation: AAV67949.1
BC013735 mRNA Translation: AAH13735.1
BC032542 mRNA Translation: AAH32542.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10891.2 [Q8N0W3-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC7878

NCBI Reference Sequences

More...
RefSeqi
NP_659496.2, NM_145059.2 [Q8N0W3-1]
XP_011521230.1, XM_011522928.1 [Q8N0W3-1]
XP_011521231.1, XM_011522929.1 [Q8N0W3-1]
XP_016878501.1, XM_017023012.1 [Q8N0W3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000288078; ENSP00000288078; ENSG00000157353 [Q8N0W3-1]
ENST00000378912; ENSP00000368192; ENSG00000157353 [Q8N0W3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
197258

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:197258

UCSC genome browser

More...
UCSCi
uc002eyy.4, human [Q8N0W3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ441184 mRNA Translation: CAD29647.1 Frameshift.
AK056456 mRNA Translation: BAB71190.1 Frameshift.
AK128387 mRNA Translation: BAC87413.1
AY829643 Genomic DNA Translation: AAV67949.1
BC013735 mRNA Translation: AAH13735.1
BC032542 mRNA Translation: AAH32542.2
CCDSiCCDS10891.2 [Q8N0W3-1]
PIRiJC7878
RefSeqiNP_659496.2, NM_145059.2 [Q8N0W3-1]
XP_011521230.1, XM_011522928.1 [Q8N0W3-1]
XP_011521231.1, XM_011522929.1 [Q8N0W3-1]
XP_016878501.1, XM_017023012.1 [Q8N0W3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi128243, 5 interactors
IntActiQ8N0W3, 5 interactors
STRINGi9606.ENSP00000288078

PTM databases

iPTMnetiQ8N0W3
PhosphoSitePlusiQ8N0W3

Polymorphism and mutation databases

BioMutaiFUK
DMDMi73915340

Proteomic databases

EPDiQ8N0W3
jPOSTiQ8N0W3
MassIVEiQ8N0W3
MaxQBiQ8N0W3
PaxDbiQ8N0W3
PeptideAtlasiQ8N0W3
PRIDEiQ8N0W3
ProteomicsDBi71470 [Q8N0W3-1]
71471 [Q8N0W3-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29979, 143 antibodies

The DNASU plasmid repository

More...
DNASUi
197258

Genome annotation databases

EnsembliENST00000288078; ENSP00000288078; ENSG00000157353 [Q8N0W3-1]
ENST00000378912; ENSP00000368192; ENSG00000157353 [Q8N0W3-2]
GeneIDi197258
KEGGihsa:197258
UCSCiuc002eyy.4, human [Q8N0W3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
197258
DisGeNETi197258
EuPathDBiHostDB:ENSG00000157353.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FCSK
HGNCiHGNC:29500, FCSK
HPAiENSG00000157353, Low tissue specificity
MalaCardsiFCSK
MIMi608675, gene
618324, phenotype
neXtProtiNX_Q8N0W3
OpenTargetsiENSG00000157353
PharmGKBiPA134863646

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4644, Eukaryota
GeneTreeiENSGT00390000002251
HOGENOMiCLU_006983_0_0_1
InParanoidiQ8N0W3
KOiK05305
OMAiEMGQGDM
OrthoDBi135001at2759
PhylomeDBiQ8N0W3
TreeFamiTF314554

Enzyme and pathway databases

BRENDAi2.7.1.52, 2681
PathwayCommonsiQ8N0W3
ReactomeiR-HSA-6787639, GDP-fucose biosynthesis

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
197258, 5 hits in 872 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FUK, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
197258
PharosiQ8N0W3, Tbio

Protein Ontology

More...
PROi
PR:Q8N0W3
RNActiQ8N0W3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157353, Expressed in right hemisphere of cerebellum and 186 other tissues
ExpressionAtlasiQ8N0W3, baseline and differential
GenevisibleiQ8N0W3, HS

Family and domain databases

InterProiView protein in InterPro
IPR012887, Fucokinase
IPR013750, GHMP_kinase_C_dom
IPR036554, GHMP_kinase_C_sf
IPR006204, GHMP_kinase_N_dom
IPR020568, Ribosomal_S5_D2-typ_fold
PfamiView protein in Pfam
PF07959, Fucokinase, 1 hit
PF08544, GHMP_kinases_C, 1 hit
PF00288, GHMP_kinases_N, 1 hit
SUPFAMiSSF54211, SSF54211, 1 hit
SSF55060, SSF55060, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFCSK_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N0W3
Secondary accession number(s): Q5PSM3
, Q5XKL6, Q6ZRA0, Q96MT9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: August 30, 2005
Last modified: August 12, 2020
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again