Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

L-fucose kinase

Gene

FUK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides.

Catalytic activityi

ATP + L-fucose = ADP + beta-L-fucose 1-phosphate.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi834 – 845ATPSequence analysisAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.1.52 2681
ReactomeiR-HSA-6787639 GDP-fucose biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
L-fucose kinase (EC:2.7.1.52)
Short name:
Fucokinase
Gene namesi
Name:FUK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000157353.16
HGNCiHGNC:29500 FUK
MIMi608675 gene
neXtProtiNX_Q8N0W3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000157353
PharmGKBiPA134863646

Polymorphism and mutation databases

BioMutaiFUK
DMDMi73915340

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001566721 – 1084L-fucose kinaseAdd BLAST1084

Proteomic databases

EPDiQ8N0W3
MaxQBiQ8N0W3
PaxDbiQ8N0W3
PeptideAtlasiQ8N0W3
PRIDEiQ8N0W3
ProteomicsDBi71470
71471 [Q8N0W3-2]

PTM databases

iPTMnetiQ8N0W3
PhosphoSitePlusiQ8N0W3

Expressioni

Gene expression databases

BgeeiENSG00000157353 Expressed in 171 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_FUK
ExpressionAtlasiQ8N0W3 baseline and differential
GenevisibleiQ8N0W3 HS

Organism-specific databases

HPAiHPA041971

Interactioni

Protein-protein interaction databases

BioGridi128243, 5 interactors
IntActiQ8N0W3, 1 interactor
STRINGi9606.ENSP00000288078

Structurei

3D structure databases

ProteinModelPortaliQ8N0W3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the GHMP kinase family.Curated

Phylogenomic databases

eggNOGiKOG4644 Eukaryota
ENOG4111FB6 LUCA
GeneTreeiENSGT00390000002251
HOGENOMiHOG000294126
HOVERGENiHBG021773
InParanoidiQ8N0W3
KOiK05305
OMAiCLLEGPV
OrthoDBiEOG091G04JR
PhylomeDBiQ8N0W3
TreeFamiTF314554

Family and domain databases

InterProiView protein in InterPro
IPR012887 Fucokinase
IPR013750 GHMP_kinase_C_dom
IPR036554 GHMP_kinase_C_sf
IPR006204 GHMP_kinase_N_dom
IPR020568 Ribosomal_S5_D2-typ_fold
PfamiView protein in Pfam
PF07959 Fucokinase, 1 hit
PF08544 GHMP_kinases_C, 1 hit
PF00288 GHMP_kinases_N, 1 hit
SUPFAMiSSF54211 SSF54211, 1 hit
SSF55060 SSF55060, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N0W3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQPKGVDWT VIILTCQYKD SVQVFQRELE VRQKREQIPA GTLLLAVEDP
60 70 80 90 100
EKRVGSGGAT LNALLVAAEH LSARAGFTVV TSDVLHSAWI LILHMGRDFP
110 120 130 140 150
FDDCGRAFTC LPVENPEAPV EALVCNLDCL LDIMTYRLGP GSPPGVWVCS
160 170 180 190 200
TDMLLSVPAN PGISWDSFRG ARVIALPGSP AYAQNHGVYL TDPQGLVLDI
210 220 230 240 250
YYQGTEAEIQ RCVRPDGRVP LVSGVVFFSV ETAERLLATH VSPPLDACTY
260 270 280 290 300
LGLDSGARPV QLSLFFDILH CMAENVTRED FLVGRPPELG QGDADVAGYL
310 320 330 340 350
QSARAQLWRE LRDQPLTMAY VSSGSYSYMT SSASEFLLSL TLPGAPGAQI
360 370 380 390 400
VHSQVEEQQL LAAGSSVVSC LLEGPVQLGP GSVLQHCHLQ GPIHIGAGCL
410 420 430 440 450
VTGLDTAHSK ALHGRELRDL VLQGHHTRLH GSPGHAFTLV GRLDSWERQG
460 470 480 490 500
AGTYLNVPWS EFFKRTGVRA WDLWDPETLP AEYCLPSARL FPVLHPSREL
510 520 530 540 550
GPQDLLWMLD HQEDGGEALR AWRASWRLSW EQLQPCLDRA ATLASRRDLF
560 570 580 590 600
FRQALHKARH VLEARQDLSL RPLIWAAVRE GCPGPLLATL DQVAAGAGDP
610 620 630 640 650
GVAARALACV ADVLGCMAEG RGGLRSGPAA NPEWMRPFSY LECGDLAAGV
660 670 680 690 700
EALAQERDKW LSRPALLVRA ARHYEGAGQI LIRQAVMSAQ HFVSTEQVEL
710 720 730 740 750
PGPGQWVVAE CPARVDFSGG WSDTPPLAYE LGGAVLGLAV RVDGRRPIGA
760 770 780 790 800
RARRIPEPEL WLAVGPRQDE MTVKIVCRCL ADLRDYCQPH APGALLKAAF
810 820 830 840 850
ICAGIVHVHS ELQLSEQLLR TFGGGFELHT WSELPHGSGL GTSSILAGTA
860 870 880 890 900
LAALQRAAGR VVGTEALIHA VLHLEQVLTT GGGWQDQVGG LMPGIKVGRS
910 920 930 940 950
RAQLPLKVEV EEVTVPEGFV QKLNDHLLLV YTGKTRLARN LLQDVLRSWY
960 970 980 990 1000
ARLPAVVQNA HSLVRQTEEC AEGFRQGSLP LLGQCLTSYW EQKKLMAPGC
1010 1020 1030 1040 1050
EPLTVRRMMD VLAPHVHGQS LAGAGGGGFL YLLTKEPQQK EALEAVLAKT
1060 1070 1080
EGLGNYSIHL VEVDTQGLSL KLLGTEASTC CPFP
Length:1,084
Mass (Da):117,623
Last modified:August 30, 2005 - v2
Checksum:i153F91882F4B143C
GO
Isoform 2 (identifier: Q8N0W3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     78-78: T → TWICVGVSLWIRGCHPPGRLPEASVHRAFPLLQ
     816-841: Missing.

Note: No experimental confirmation available.
Show »
Length:1,090
Mass (Da):118,393
Checksum:i8522A425A0832887
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KSP6J3KSP6_HUMAN
Fucokinase, isoform CRA_d
FUK hCG_1774069
575Annotation score:
J3KTP6J3KTP6_HUMAN
L-fucose kinase
FUK
203Annotation score:
I3L1X0I3L1X0_HUMAN
L-fucose kinase
FUK
156Annotation score:
I3L171I3L171_HUMAN
L-fucose kinase
FUK
146Annotation score:
I3L106I3L106_HUMAN
L-fucose kinase
FUK
120Annotation score:
I3L3J1I3L3J1_HUMAN
L-fucose kinase
FUK
109Annotation score:

Sequence cautioni

The sequence BAB71190 differs from that shown. Reason: Frameshift at position 19.Curated
The sequence CAD29647 differs from that shown. Reason: Frameshift at position 19.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti400L → S in BAB71190 (PubMed:14702039).Curated1
Sequence conflicti609C → R in BAB71190 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_021327146V → M1 PublicationCorresponds to variant dbSNP:rs17881323Ensembl.1
Natural variantiVAR_021328521A → T1 PublicationCorresponds to variant dbSNP:rs17881069Ensembl.1
Natural variantiVAR_021329571R → H1 PublicationCorresponds to variant dbSNP:rs17886171Ensembl.1
Natural variantiVAR_021330701P → L1 PublicationCorresponds to variant dbSNP:rs17883716Ensembl.1
Natural variantiVAR_021331858A → T1 PublicationCorresponds to variant dbSNP:rs17884050Ensembl.1
Natural variantiVAR_021332861V → M1 PublicationCorresponds to variant dbSNP:rs17878599Ensembl.1
Natural variantiVAR_021333901R → W1 PublicationCorresponds to variant dbSNP:rs17881635Ensembl.1
Natural variantiVAR_021334939R → Q1 PublicationCorresponds to variant dbSNP:rs17886060Ensembl.1
Natural variantiVAR_021335939R → W1 PublicationCorresponds to variant dbSNP:rs17883248Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01542278T → TWICVGVSLWIRGCHPPGRL PEASVHRAFPLLQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_015423816 – 841Missing in isoform 2. 1 PublicationAdd BLAST26

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ441184 mRNA Translation: CAD29647.1 Frameshift.
AK056456 mRNA Translation: BAB71190.1 Frameshift.
AK128387 mRNA Translation: BAC87413.1
AY829643 Genomic DNA Translation: AAV67949.1
BC013735 mRNA Translation: AAH13735.1
BC032542 mRNA Translation: AAH32542.2
CCDSiCCDS10891.2 [Q8N0W3-1]
PIRiJC7878
RefSeqiNP_659496.2, NM_145059.2 [Q8N0W3-1]
XP_011521230.1, XM_011522928.1 [Q8N0W3-1]
XP_011521231.1, XM_011522929.1 [Q8N0W3-1]
XP_016878501.1, XM_017023012.1 [Q8N0W3-1]
UniGeneiHs.7907

Genome annotation databases

EnsembliENST00000288078; ENSP00000288078; ENSG00000157353 [Q8N0W3-1]
ENST00000378912; ENSP00000368192; ENSG00000157353 [Q8N0W3-2]
GeneIDi197258
KEGGihsa:197258
UCSCiuc002eyy.4 human [Q8N0W3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ441184 mRNA Translation: CAD29647.1 Frameshift.
AK056456 mRNA Translation: BAB71190.1 Frameshift.
AK128387 mRNA Translation: BAC87413.1
AY829643 Genomic DNA Translation: AAV67949.1
BC013735 mRNA Translation: AAH13735.1
BC032542 mRNA Translation: AAH32542.2
CCDSiCCDS10891.2 [Q8N0W3-1]
PIRiJC7878
RefSeqiNP_659496.2, NM_145059.2 [Q8N0W3-1]
XP_011521230.1, XM_011522928.1 [Q8N0W3-1]
XP_011521231.1, XM_011522929.1 [Q8N0W3-1]
XP_016878501.1, XM_017023012.1 [Q8N0W3-1]
UniGeneiHs.7907

3D structure databases

ProteinModelPortaliQ8N0W3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128243, 5 interactors
IntActiQ8N0W3, 1 interactor
STRINGi9606.ENSP00000288078

PTM databases

iPTMnetiQ8N0W3
PhosphoSitePlusiQ8N0W3

Polymorphism and mutation databases

BioMutaiFUK
DMDMi73915340

Proteomic databases

EPDiQ8N0W3
MaxQBiQ8N0W3
PaxDbiQ8N0W3
PeptideAtlasiQ8N0W3
PRIDEiQ8N0W3
ProteomicsDBi71470
71471 [Q8N0W3-2]

Protocols and materials databases

DNASUi197258
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288078; ENSP00000288078; ENSG00000157353 [Q8N0W3-1]
ENST00000378912; ENSP00000368192; ENSG00000157353 [Q8N0W3-2]
GeneIDi197258
KEGGihsa:197258
UCSCiuc002eyy.4 human [Q8N0W3-1]

Organism-specific databases

CTDi197258
EuPathDBiHostDB:ENSG00000157353.16
GeneCardsiFUK
H-InvDBiHIX0013200
HGNCiHGNC:29500 FUK
HPAiHPA041971
MIMi608675 gene
neXtProtiNX_Q8N0W3
OpenTargetsiENSG00000157353
PharmGKBiPA134863646
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4644 Eukaryota
ENOG4111FB6 LUCA
GeneTreeiENSGT00390000002251
HOGENOMiHOG000294126
HOVERGENiHBG021773
InParanoidiQ8N0W3
KOiK05305
OMAiCLLEGPV
OrthoDBiEOG091G04JR
PhylomeDBiQ8N0W3
TreeFamiTF314554

Enzyme and pathway databases

BRENDAi2.7.1.52 2681
ReactomeiR-HSA-6787639 GDP-fucose biosynthesis

Miscellaneous databases

ChiTaRSiFUK human
GenomeRNAii197258
PROiPR:Q8N0W3
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000157353 Expressed in 171 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_FUK
ExpressionAtlasiQ8N0W3 baseline and differential
GenevisibleiQ8N0W3 HS

Family and domain databases

InterProiView protein in InterPro
IPR012887 Fucokinase
IPR013750 GHMP_kinase_C_dom
IPR036554 GHMP_kinase_C_sf
IPR006204 GHMP_kinase_N_dom
IPR020568 Ribosomal_S5_D2-typ_fold
PfamiView protein in Pfam
PF07959 Fucokinase, 1 hit
PF08544 GHMP_kinases_C, 1 hit
PF00288 GHMP_kinases_N, 1 hit
SUPFAMiSSF54211 SSF54211, 1 hit
SSF55060 SSF55060, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFUK_HUMAN
AccessioniPrimary (citable) accession number: Q8N0W3
Secondary accession number(s): Q5PSM3
, Q5XKL6, Q6ZRA0, Q96MT9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: August 30, 2005
Last modified: October 10, 2018
This is version 134 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again