Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (10 Feb 2021)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Uncharacterized protein C1orf87

Gene

C1orf87

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8N0U7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein C1orf87
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:C1orf87
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28547, C1orf87

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618860, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N0U7

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000162598.13

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
127795

Open Targets

More...
OpenTargetsi
ENSG00000162598

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672471

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8N0U7, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C1orf87

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74759752

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002844891 – 546Uncharacterized protein C1orf87Add BLAST546

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8N0U7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N0U7

PeptideAtlas

More...
PeptideAtlasi
Q8N0U7

PRoteomics IDEntifications database

More...
PRIDEi
Q8N0U7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
71460 [Q8N0U7-1]
71461 [Q8N0U7-2]
71462 [Q8N0U7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N0U7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N0U7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162598, Expressed in bronchial epithelial cell and 96 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N0U7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N0U7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000162598, Tissue enhanced (brain, fallopian tube)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126083, 19 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N0U7, 17 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000360244

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8N0U7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N0U7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RIAR, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008678

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_040182_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N0U7

Identification of Orthologs from Complete Genome Data

More...
OMAi
HSFSGCL

Database of Orthologous Groups

More...
OrthoDBi
950399at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N0U7

TreeFam database of animal gene trees

More...
TreeFami
TF338576

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040774, DUF5580
IPR011992, EF-hand-dom_pair

The PANTHER Classification System

More...
PANTHERi
PTHR34830, PTHR34830, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17743, DUF5580, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N0U7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSAWKTPRG SDAMPEIMVK IIGSKHFQYL VEKPKIKEND SLKTETQTMH
60 70 80 90 100
QKPMTDNARQ MSRDTPVPIN FTDQQTTDNP DDVKEKKHPE NNQKSENNQK
110 120 130 140 150
LLTGANSSRF LDGNIPSQAN VHCSSVPTGD QSLSYVHGIP RRKLRDWSLE
160 170 180 190 200
QMVRGSSDQP EDIGQSPSGT TNEDAFLLAL VRRELKSRPL SSNLLEKLQK
210 220 230 240 250
ELKILDPISS GFLLQSQLSR LFLKHEVPLQ LPTVKILCQR FSKRGSPEMV
260 270 280 290 300
NYEKLLWFLN SAASDYPQQN KAAADLRKTE SHGTHSQSTP PQHSSSQPEV
310 320 330 340 350
NRSLLEILKM ALRTTNGRLN IDNLNLSFRK EDRSFSGCLP LPKVRAICGK
360 370 380 390 400
HGLYLTLSLL ETLLNHQDLG YQNEIKWQNF VEMLTRASSD LLSDLPTGKN
410 420 430 440 450
EKKAPAPPME PEVPEMSQSK TEHMKTPEEE LQPESSPAET SACKDPLKPL
460 470 480 490 500
KIRPVSQPFV NPAVKNKAEE CETWIDRFRK LENALYLCDL SNTGVLEKER
510 520 530 540
ARRLIHNYNL IYNLSLSPQK IDQALRRFRS GENMLLEPAL RYLKEL
Length:546
Mass (Da):62,035
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDDC8452AFC30FDA2
GO
Isoform 2 (identifier: Q8N0U7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-366: Missing.
     367-397: QDLGYQNEIKWQNFVEMLTRASSDLLSDLPT → MSRGCSSDLRFHTWLGLRMLKNIIAVALLML

Show »
Length:180
Mass (Da):20,687
Checksum:iF7C9D361E95655A3
GO
Isoform 3 (identifier: Q8N0U7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-408: Missing.

Show »
Length:138
Mass (Da):16,039
Checksum:i0962DEFAB18E4515
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JPP7C9JPP7_HUMAN
Uncharacterized protein C1orf87
C1orf87
317Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035493151Q → E in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_031745185L → V. Corresponds to variant dbSNP:rs12737449Ensembl.1
Natural variantiVAR_031746301N → D. Corresponds to variant dbSNP:rs17120025Ensembl.1
Natural variantiVAR_031747403K → E1 PublicationCorresponds to variant dbSNP:rs626251Ensembl.1
Natural variantiVAR_031748406A → P. Corresponds to variant dbSNP:rs35260089Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0245401 – 408Missing in isoform 3. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_0245411 – 366Missing in isoform 2. 1 PublicationAdd BLAST366
Alternative sequenceiVSP_024542367 – 397QDLGY…SDLPT → MSRGCSSDLRFHTWLGLRML KNIIAVALLML in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK126061 mRNA Translation: BAC86420.1
BC027878 mRNA Translation: AAH27878.1
BC042203 mRNA Translation: AAH42203.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS614.1 [Q8N0U7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_689590.1, NM_152377.2 [Q8N0U7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000371201; ENSP00000360244; ENSG00000162598 [Q8N0U7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
127795

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:127795

UCSC genome browser

More...
UCSCi
uc001czs.3, human [Q8N0U7-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK126061 mRNA Translation: BAC86420.1
BC027878 mRNA Translation: AAH27878.1
BC042203 mRNA Translation: AAH42203.1
CCDSiCCDS614.1 [Q8N0U7-1]
RefSeqiNP_689590.1, NM_152377.2 [Q8N0U7-1]

3D structure databases

SMRiQ8N0U7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi126083, 19 interactors
IntActiQ8N0U7, 17 interactors
STRINGi9606.ENSP00000360244

PTM databases

iPTMnetiQ8N0U7
PhosphoSitePlusiQ8N0U7

Genetic variation databases

BioMutaiC1orf87
DMDMi74759752

Proteomic databases

MassIVEiQ8N0U7
PaxDbiQ8N0U7
PeptideAtlasiQ8N0U7
PRIDEiQ8N0U7
ProteomicsDBi71460 [Q8N0U7-1]
71461 [Q8N0U7-2]
71462 [Q8N0U7-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33284, 74 antibodies

The DNASU plasmid repository

More...
DNASUi
127795

Genome annotation databases

EnsembliENST00000371201; ENSP00000360244; ENSG00000162598 [Q8N0U7-1]
GeneIDi127795
KEGGihsa:127795
UCSCiuc001czs.3, human [Q8N0U7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
127795
DisGeNETi127795

GeneCards: human genes, protein and diseases

More...
GeneCardsi
C1orf87
HGNCiHGNC:28547, C1orf87
HPAiENSG00000162598, Tissue enhanced (brain, fallopian tube)
MIMi618860, gene
neXtProtiNX_Q8N0U7
OpenTargetsiENSG00000162598
PharmGKBiPA142672471
VEuPathDBiHostDB:ENSG00000162598.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RIAR, Eukaryota
GeneTreeiENSGT00390000008678
HOGENOMiCLU_040182_0_0_1
InParanoidiQ8N0U7
OMAiHSFSGCL
OrthoDBi950399at2759
PhylomeDBiQ8N0U7
TreeFamiTF338576

Enzyme and pathway databases

PathwayCommonsiQ8N0U7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
127795, 12 hits in 869 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C1orf87, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
127795
PharosiQ8N0U7, Tbio

Protein Ontology

More...
PROi
PR:Q8N0U7
RNActiQ8N0U7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162598, Expressed in bronchial epithelial cell and 96 other tissues
ExpressionAtlasiQ8N0U7, baseline and differential
GenevisibleiQ8N0U7, HS

Family and domain databases

InterProiView protein in InterPro
IPR040774, DUF5580
IPR011992, EF-hand-dom_pair
PANTHERiPTHR34830, PTHR34830, 1 hit
PfamiView protein in Pfam
PF17743, DUF5580, 1 hit
SUPFAMiSSF47473, SSF47473, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCA087_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N0U7
Secondary accession number(s): Q6ZU07, Q8IVS0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: October 1, 2002
Last modified: February 10, 2021
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again