Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (08 May 2019)
Sequence version 2 (28 Nov 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Synaptonemal complex central element protein 1

Gene

SYCE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complex assembly, stabilization and recombination.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Meiosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1221632 Meiotic synapsis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptonemal complex central element protein 1
Alternative name(s):
Cancer/testis antigen 76
Short name:
CT76
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SYCE1
Synonyms:C10orf94
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28852 SYCE1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611486 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8N0S2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Premature ovarian failure 12 (POF12)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.
See also OMIM:616947
Spermatogenic failure, 15 (SPGF15)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn infertility disorder caused by spermatogenesis defects and characterized by non-obstructive azoospermia due to complete meiotic maturation arrest. SPGF15 inheritance is autosomal recessive.
See also OMIM:616950

Keywords - Diseasei

Premature ovarian failure

Organism-specific databases

DisGeNET

More...
DisGeNETi
93426

MalaCards human disease database

More...
MalaCardsi
SYCE1
MIMi616947 phenotype
616950 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000171772

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
399805 Male infertility with azoospermia or oligozoospermia due to single gene mutation
619 NON RARE IN EUROPE: Primary ovarian failure

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134876767

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SYCE1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
118573896

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002614261 – 351Synaptonemal complex central element protein 1Add BLAST351

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8N0S2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8N0S2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8N0S2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8N0S2

PeptideAtlas

More...
PeptideAtlasi
Q8N0S2

PRoteomics IDEntifications database

More...
PRIDEi
Q8N0S2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
71447
71448 [Q8N0S2-2]
71449 [Q8N0S2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8N0S2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8N0S2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171772 Expressed in 93 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8N0S2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8N0S2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040208

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Found in a complex with SYCP1 and SYCE2. Interacts with SYCP1, SYCE2 and SYCE3. Interacts with SIX6OS1.By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125023, 108 interactors

Protein interaction database and analysis system

More...
IntActi
Q8N0S2, 52 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341282

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8N0S2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili52 – 290Sequence analysisAdd BLAST239

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi259 – 297Gln-richAdd BLAST39

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SYCE family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJFM Eukaryota
ENOG410YHCQ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017352

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000059636

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8N0S2

KEGG Orthology (KO)

More...
KOi
K19534

Identification of Orthologs from Complete Genome Data

More...
OMAi
EFHRPEQ

Database of Orthologous Groups

More...
OrthoDBi
1275708at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8N0S2

TreeFam database of animal gene trees

More...
TreeFami
TF337303

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026676 SYCE1

The PANTHER Classification System

More...
PANTHERi
PTHR21731 PTHR21731, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15233 SYCE1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8N0S2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGRSLTSKA EPTAGAVDRA EKAGGQDTSS QKIEDLMEMV QKLQKVGSLE
60 70 80 90 100
PRVEVLINRI NEVQQAKKKA NKDLGEARTI CEALQKELDS LHGEKVHLKE
110 120 130 140 150
ILSKKQETLR ILRLHCQEKE SEAHRKHTML QECKERISAL NLQIEEEKNK
160 170 180 190 200
QRQLRLAFEE QLEDLMGQHK DLWDFHMPER LAKEICALDS SKEQLLKEEK
210 220 230 240 250
LVKATLEDVK HQLCSLCGAE GPSTLDEGLF LRSQEAAATV QLFQEEHRKA
260 270 280 290 300
EELLAAAAQR HQQLQQKCQQ QQQKRQRLKE ELEKHGMQVP AQAQSTQEEE
310 320 330 340 350
AGPGDVASPK PLKGERPGAA HQAGPDVLIG QEDTLHPDLS PRGFQEIKEL

F
Length:351
Mass (Da):39,699
Last modified:November 28, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i12E45FF6696080F8
GO
Isoform 2 (identifier: Q8N0S2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.
     308-351: SPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKELF → PRPGRPVTWWS

Show »
Length:282
Mass (Da):32,601
Checksum:iB0D483BF27BB31C7
GO
Isoform 3 (identifier: Q8N0S2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-128: Missing.
     308-351: SPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKELF → PRPGRPVTWWS

Note: No experimental confirmation available.
Show »
Length:190
Mass (Da):21,902
Checksum:iC888D4B18C59550B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4J1R9A0A0B4J1R9_HUMAN
Synaptonemal complex central elemen...
SYCE1
318Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT28A0A0A0MT28_HUMAN
Synaptonemal complex central elemen...
SYCE1
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH34821 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti321H → R in AAH34821 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_029385132E → D1 PublicationCorresponds to variant dbSNP:rs8181357Ensembl.1
Natural variantiVAR_029386183K → R1 PublicationCorresponds to variant dbSNP:rs3747881Ensembl.1
Natural variantiVAR_029387317P → A. Corresponds to variant dbSNP:rs1313001903Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0216901 – 128Missing in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_0216911 – 36Missing in isoform 2. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_021692308 – 351SPKPL…IKELF → PRPGRPVTWWS in isoform 2 and isoform 3. 2 PublicationsAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY027807 mRNA Translation: AAK14796.1
AY027808 mRNA Translation: AAK14797.1
AY028079 Genomic DNA Translation: AAK21976.1
AK314978 mRNA Translation: BAG37477.1
AL161645 Genomic DNA No translation available.
CH471211 Genomic DNA Translation: EAW61359.1
BC034821 mRNA Translation: AAH34821.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7687.1 [Q8N0S2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001137235.1, NM_001143763.1
NP_570140.1, NM_130784.3 [Q8N0S2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343131; ENSP00000341282; ENSG00000171772 [Q8N0S2-1]
ENST00000368517; ENSP00000357503; ENSG00000171772 [Q8N0S2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
93426

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:93426

UCSC genome browser

More...
UCSCi
uc001lno.2 human [Q8N0S2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY027807 mRNA Translation: AAK14796.1
AY027808 mRNA Translation: AAK14797.1
AY028079 Genomic DNA Translation: AAK21976.1
AK314978 mRNA Translation: BAG37477.1
AL161645 Genomic DNA No translation available.
CH471211 Genomic DNA Translation: EAW61359.1
BC034821 mRNA Translation: AAH34821.1 Different initiation.
CCDSiCCDS7687.1 [Q8N0S2-2]
RefSeqiNP_001137235.1, NM_001143763.1
NP_570140.1, NM_130784.3 [Q8N0S2-2]

3D structure databases

SMRiQ8N0S2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125023, 108 interactors
IntActiQ8N0S2, 52 interactors
STRINGi9606.ENSP00000341282

PTM databases

iPTMnetiQ8N0S2
PhosphoSitePlusiQ8N0S2

Polymorphism and mutation databases

BioMutaiSYCE1
DMDMi118573896

Proteomic databases

EPDiQ8N0S2
jPOSTiQ8N0S2
MaxQBiQ8N0S2
PaxDbiQ8N0S2
PeptideAtlasiQ8N0S2
PRIDEiQ8N0S2
ProteomicsDBi71447
71448 [Q8N0S2-2]
71449 [Q8N0S2-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
93426
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343131; ENSP00000341282; ENSG00000171772 [Q8N0S2-1]
ENST00000368517; ENSP00000357503; ENSG00000171772 [Q8N0S2-2]
GeneIDi93426
KEGGihsa:93426
UCSCiuc001lno.2 human [Q8N0S2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
93426
DisGeNETi93426

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SYCE1
HGNCiHGNC:28852 SYCE1
HPAiHPA040208
MalaCardsiSYCE1
MIMi611486 gene
616947 phenotype
616950 phenotype
neXtProtiNX_Q8N0S2
OpenTargetsiENSG00000171772
Orphaneti399805 Male infertility with azoospermia or oligozoospermia due to single gene mutation
619 NON RARE IN EUROPE: Primary ovarian failure
PharmGKBiPA134876767

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJFM Eukaryota
ENOG410YHCQ LUCA
GeneTreeiENSGT00390000017352
HOGENOMiHOG000059636
InParanoidiQ8N0S2
KOiK19534
OMAiEFHRPEQ
OrthoDBi1275708at2759
PhylomeDBiQ8N0S2
TreeFamiTF337303

Enzyme and pathway databases

ReactomeiR-HSA-1221632 Meiotic synapsis

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
93426

Protein Ontology

More...
PROi
PR:Q8N0S2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171772 Expressed in 93 organ(s), highest expression level in testis
ExpressionAtlasiQ8N0S2 baseline and differential
GenevisibleiQ8N0S2 HS

Family and domain databases

InterProiView protein in InterPro
IPR026676 SYCE1
PANTHERiPTHR21731 PTHR21731, 1 hit
PfamiView protein in Pfam
PF15233 SYCE1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSYCE1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8N0S2
Secondary accession number(s): B2RC80, Q9BWU3, Q9BWU4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: May 8, 2019
This is version 129 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again