Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras GTPase-activating protein gap-2

Gene

gap-2

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GTPase-activating protein, which acts as a negative regulator for the member of the Ras family let-60. Probably decreases the signaling activity of Ras by stimulating its intinsic GTPase activity, thereby lowering the levels of GTP-bound, active Ras. The different isoforms may play a distinct role in specific tissues.1 Publication

GO - Molecular functioni

  • GTPase activator activity Source: UniProtKB

GO - Biological processi

  • associative learning Source: WormBase
  • long-term memory Source: WormBase
  • negative regulation of Ras protein signal transduction Source: UniProtKB
  • short-term memory Source: WormBase
  • signal transduction Source: InterPro

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-CEL-5658442 Regulation of RAS by GAPs

Names & Taxonomyi

Protein namesi
Recommended name:
Ras GTPase-activating protein gap-2
Short name:
GTPase-activating protein 2
Gene namesi
Name:gap-2
ORF Names:ZK899.8
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome X

Organism-specific databases

WormBaseiZK899.8a ; CE23470 ; WBGene00001516 ; gap-2
ZK899.8b ; CE23471 ; WBGene00001516 ; gap-2
ZK899.8c ; CE23472 ; WBGene00001516 ; gap-2
ZK899.8d ; CE23473 ; WBGene00001516 ; gap-2
ZK899.8e ; CE23474 ; WBGene00001516 ; gap-2
ZK899.8f ; CE23475 ; WBGene00001516 ; gap-2
ZK899.8g ; CE28277 ; WBGene00001516 ; gap-2
ZK899.8h ; CE31677 ; WBGene00001516 ; gap-2
ZK899.8i ; CE39119 ; WBGene00001516 ; gap-2
ZK899.8j ; CE23476 ; WBGene00001516 ; gap-2
ZK899.8k ; CE48260 ; WBGene00001516 ; gap-2
ZK899.8l ; CE48295 ; WBGene00001516 ; gap-2

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000566641 – 1207Ras GTPase-activating protein gap-2Add BLAST1207

Proteomic databases

PaxDbiQ8MLZ5
PeptideAtlasiQ8MLZ5
PRIDEiQ8MLZ5

Expressioni

Tissue specificityi

Mainly expressed in gonads and vulval cells. Isoform c in expressed in pharyngeal epithelial cells and several rectal/blast cells in the tail region. Isoform f is weakly expressed in four cells symmetrically located in the vulval region. Isoform g is strongly expressed in the pharyngeal muscle cells m6 in addition to several cells in the tail region.1 Publication

Gene expression databases

BgeeiWBGene00001516 Expressed in 7 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

Interactioni

Protein-protein interaction databases

BioGridi46088, 1 interactor
IntActiQ8MLZ5, 1 interactor
STRINGi6239.ZK899.8c

Structurei

3D structure databases

ProteinModelPortaliQ8MLZ5
SMRiQ8MLZ5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 383PHAdd BLAST344
Domaini395 – 474C2Add BLAST80
Domaini563 – 757Ras-GAPPROSITE-ProRule annotationAdd BLAST195

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi986 – 1014Ser-richAdd BLAST29

Phylogenomic databases

eggNOGiKOG3508 Eukaryota
ENOG410XPU1 LUCA
GeneTreeiENSGT00760000119092
HOGENOMiHOG000000696
InParanoidiQ8MLZ5
OMAiITGPHTI
OrthoDBiEOG091G05TS
PhylomeDBiQ8MLZ5

Family and domain databases

Gene3Di2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001849 PH_domain
IPR039360 Ras_GTPase
IPR023152 RasGAP_CS
IPR001936 RasGAP_dom
IPR008936 Rho_GTPase_activation_prot
PANTHERiPTHR10194 PTHR10194, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF00616 RasGAP, 2 hits
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00233 PH, 1 hit
SM00323 RasGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS00509 RAS_GTPASE_ACTIV_1, 1 hit
PS50018 RAS_GTPASE_ACTIV_2, 1 hit

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform aImported (identifier: Q8MLZ5-1) [UniParc]FASTAAdd to basket
Also known as: GAP-2-11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKVIDEKPED EEEEKDSGSK CKTPSSCTKK RVREKEEDLP PICHGWLIVC
60 70 80 90 100
EGNPTKMMNK EVKLPWHAGY CVFEPRQSTM SCYKQEYPFI AGRMLHRNRT
110 120 130 140 150
VRMDGDRSAF ARHWGLLPEH YPSPPITGPH TIARSYTRPP KDRLPTKERF
160 170 180 190 200
FSISRIPSRL TKFSTVRGMS IEFFDAIHDE TNSGGAQVGG ESLDRRGWSG
210 220 230 240 250
ASTGNRTTLT ASVHNNLMNG RMSSSSHNLS TRLSGSTQNL NQPTNAYGNL
260 270 280 290 300
LSRPFRSNPL KRTKSVSKME KSLAEANQHS LHRVDASNTP SRDSSLYAQP
310 320 330 340 350
PARRHLSQPA REGSLRACRS HESLLSSAHS THMIELNEDN RLHPVHPSIF
360 370 380 390 400
EVPNCFRLAS TYYSCRTPLE RAKWMENLRK TMNPRRDQQR RTENSMLIWI
410 420 430 440 450
LEAKGLPAKR KYYCEMTLDK TLYAKTSSKA RTDNVFWGEN FEFMMLPKID
460 470 480 490 500
EVCVSLFRES DSKKKKDTLI GYVTIGIDQL SSRSPVERWY TVNTSHSDSG
510 520 530 540 550
TSRIASALGG KSSSQESPSL RIKARWQSVH ILPLRAYDNL LETLCYNYLP
560 570 580 590 600
LCEQLEPVLN VRDKEDLATS LVRVMYKHNL AKEFLCDLIM KEVEKLDNDH
610 620 630 640 650
LMFRGNTLAT KAMESFMKLV ADDYLDSTLS DFIKTVLQCE DSCEVDPQKL
660 670 680 690 700
GNVSNSSLEK NRALLMRYVE VAWTKILNNV HQLPKNLRDV FSALRCRLEA
710 720 730 740 750
QNREALADTL ISSSIFLRFL CPAILSPSLF NLVSEYPSPT NARNLTLIAK
760 770 780 790 800
TLQNLANFSK FGGKEPHMEF MNEFVDREWH RMKDFLLRIS SESKSGPEKN
810 820 830 840 850
ADAIVDAGKE LSLIATYLEE AWTPLLQEKN GNKHPLSNVK SVLSELAECK
860 870 880 890 900
RRSDNGVFHS PMVQQPSSDY ENSPQQHVVP RHENVPAYRS TPPTGQATVL
910 920 930 940 950
GRSTNRPATH LLTSDDYVLS SAFQTPSLRP GGTRLSDETG TSSSRTSDKT
960 970 980 990 1000
TSSAEIRDDT DSDFELREDR GRGGRNRKRL PRTDASPSSS QQASSGYLSN
1010 1020 1030 1040 1050
NPSRSSYSNS SSSSPVERMA ALSIANPVFG PGPSSGYAIP AEPKEIVYQK
1060 1070 1080 1090 1100
RASPPPYDPD VHNYHYQPMQ VYAVPPDCQV SPRTQATGGV NAQNRLSLPR
1110 1120 1130 1140 1150
TNPRASRNST LLRPSVVNVP DDWDRTSDYW RDRGENNYRS QLESQVESQA
1160 1170 1180 1190 1200
REIERLMREN IELKSKMMSS TKTVDSKRSD SGASEDSYDS LSSLDRPSRQ

SLVVVPN
Length:1,207
Mass (Da):136,247
Last modified:July 19, 2003 - v2
Checksum:iEA222578D689795F
GO
Isoform bImported (identifier: Q8MLZ5-2) [UniParc]FASTAAdd to basket
Also known as: GAP-2-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.
     248-248: G → GFPIVPPANNPSDSSASGRIA

Show »
Length:1,170
Mass (Da):131,725
Checksum:i858EDFFC58E6F542
GO
Isoform cImported (identifier: Q8MLZ5-3) [UniParc]FASTAAdd to basket
Also known as: GAP-2-31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MKVIDEKPED...TVRGMSIEFF → MHRQGVHPNA...VPSTLSLVIH
     248-248: G → GFPIVPPANNPSDSSASGRIA

Show »
Length:1,259
Mass (Da):141,210
Checksum:iD1ECF8EC9F11A3D7
GO
Isoform dImported (identifier: Q8MLZ5-4) [UniParc]FASTAAdd to basket
Also known as: GAP-2-41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     91-174: AGRMLHRNRT...TVRGMSIEFF → MHTPSPIPQE...VPSTLSLVIH
     248-248: G → GFPIVPPANNPSDSSASGRIA

Show »
Length:1,137
Mass (Da):127,824
Checksum:i3A965BC479150CEC
GO
Isoform eImported (identifier: Q8MLZ5-5) [UniParc]FASTAAdd to basket
Also known as: GAP-2-51 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-174: LTKFSTVRGMSIEFF → METFDIRPSKYGSVR

Show »
Length:1,048
Mass (Da):117,743
Checksum:iB2CC4D066C2AC32F
GO
Isoform fImported (identifier: Q8MLZ5-6) [UniParc]FASTAAdd to basket
Also known as: GAP-2-71 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-251: Missing.
     252-279: SRPFRSNPLKRTKSVSKMEKSLAEANQH → MQCLSPNREKHNANPRLVRGRIVYKSKR

Show »
Length:956
Mass (Da):108,072
Checksum:i5D769A8BFF0EE3E0
GO
Isoform gImported (identifier: Q8MLZ5-7) [UniParc]FASTAAdd to basket
Also known as: GAP-2-91 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-420: Missing.
     421-489: TLYAKTSSKA...LSSRSPVERW → MRGEYDPWDP...YVRVSSLFGE

Show »
Length:787
Mass (Da):88,435
Checksum:i97308CC5FC21A874
GO
Isoform h (identifier: Q8MLZ5-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     120-174: HYPSPPITGP...TVRGMSIEFF → MRRYGISPWYSQSTYSLNIIPEEYVPPVDYDIDFR
     248-248: G → GFPIVPPANNPSDSSASGRIA

Note: No experimental confirmation available.Curated
Show »
Length:1,088
Mass (Da):122,208
Checksum:iE06432F9BA7B9918
GO
Isoform iImported (identifier: Q8MLZ5-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-381: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:826
Mass (Da):93,047
Checksum:iCD841465F45A093D
GO
Isoform jImported (identifier: Q8MLZ5-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-489: MKVIDEKPED...LSSRSPVERW → MRGEYDPWDP...VSSLFGEYCR

Note: No experimental confirmation available.Curated
Show »
Length:790
Mass (Da):88,857
Checksum:i2B7C7B7C856BEDFF
GO
Isoform kImported (identifier: Q8MLZ5-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1069-1070: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,205
Mass (Da):135,988
Checksum:iE11AA30F518837B5
GO
Isoform lImported (identifier: Q8MLZ5-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-279: MKVIDEKPED...EKSLAEANQH → MKHMFSIRSSSYTVNIPNQP

Note: No experimental confirmation available.Curated
Show »
Length:948
Mass (Da):107,058
Checksum:i0E3862DF2932E6A2
GO

Sequence cautioni

The sequence BAA24960 differs from that shown. Reason: Frameshift at position 1097.Curated
The sequence BAA24962 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA24964 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1028V → C in BAA24960 (PubMed:9619631).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0582831 – 489MKVID…PVERW → MRGEYDPWDPSFHNSSMIPY SLASIYPSIENLPEEFSNEN NKIKNVLKNFIWSFKLKKNY VRVSSLFGEYCR in isoform j. CuratedAdd BLAST489
Alternative sequenceiVSP_0077971 – 420Missing in isoform g. CuratedAdd BLAST420
Alternative sequenceiVSP_0582841 – 381Missing in isoform i. Add BLAST381
Alternative sequenceiVSP_0582851 – 279MKVID…EANQH → MKHMFSIRSSSYTVNIPNQP in isoform l. CuratedAdd BLAST279
Alternative sequenceiVSP_0077951 – 251Missing in isoform f. CuratedAdd BLAST251
Alternative sequenceiVSP_0077901 – 174MKVID…SIEFF → MHRQGVHPNALHHLLLANKK RSNTTTCAHSTSSTPRSTYS SGSATSSLPLYVNTHAVTEQ PKAEKRVSFKDLDMSGRLPV TAQQPSSSSNHLRTGGGLHA RKLHRCDTGNMSLLERYLSR ENMHTPSPIPQEYQPQANYS SRHVHFAQSQSRRPFQRDQR NENASIRKRLSRSCDHLSDH NFSPRLPPIRRKPTKHVPST LSLVIH in isoform c. CuratedAdd BLAST174
Alternative sequenceiVSP_0077931 – 159Missing in isoform e. CuratedAdd BLAST159
Alternative sequenceiVSP_0077991 – 119Missing in isoform h. CuratedAdd BLAST119
Alternative sequenceiVSP_0077911 – 90Missing in isoform d. 1 PublicationAdd BLAST90
Alternative sequenceiVSP_0077881 – 57Missing in isoform b. CuratedAdd BLAST57
Alternative sequenceiVSP_00779291 – 174AGRML…SIEFF → MHTPSPIPQEYQPQANYSSR HVHFAQSQSRRPFQRDQRNE NASIRKRLSRSCDHLSDHNF SPRLPPIRRKPTKHVPSTLS LVIH in isoform d. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_007800120 – 174HYPSP…SIEFF → MRRYGISPWYSQSTYSLNII PEEYVPPVDYDIDFR in isoform h. CuratedAdd BLAST55
Alternative sequenceiVSP_007794160 – 174LTKFS…SIEFF → METFDIRPSKYGSVR in isoform e. CuratedAdd BLAST15
Alternative sequenceiVSP_007789248G → GFPIVPPANNPSDSSASGRI A in isoform b, isoform c, isoform d and isoform h. 1 Publication1
Alternative sequenceiVSP_007796252 – 279SRPFR…EANQH → MQCLSPNREKHNANPRLVRG RIVYKSKR in isoform f. CuratedAdd BLAST28
Alternative sequenceiVSP_007798421 – 489TLYAK…PVERW → MRGEYDPWDPSFHNSSMIPY SLASIYPSIENLPEEFSNEN NKIKNVLKNFIWSFKLKKNY VRVSSLFGE in isoform g. CuratedAdd BLAST69
Alternative sequenceiVSP_0582861069 – 1070Missing in isoform k. Curated2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011277 mRNA Translation: BAA24957.1
AB011278 mRNA Translation: BAA24958.1
AB011279 mRNA Translation: BAA24959.1
AB011280 mRNA Translation: BAA24960.1 Frameshift.
AB011281 mRNA Translation: BAA24961.1
AB011282 mRNA Translation: BAA24962.1 Different initiation.
AB011283 mRNA Translation: BAA24963.1
AB011284 mRNA Translation: BAA24964.1 Different initiation.
AB011285 mRNA Translation: BAA24965.1
Z37140, Z37979, Z46266 Genomic DNA Translation: CAA85503.1
Z46266 Genomic DNA Translation: CAA86414.2
BX284606 Genomic DNA Translation: CAJ30221.1
BX284606 Genomic DNA Translation: CAO78710.1
BX284606 Genomic DNA Translation: CCO25886.1
BX284606 Genomic DNA Translation: CCO25887.1
BX284606 Genomic DNA Translation: CCO25888.1
BX284606 Genomic DNA Translation: CCO25889.1
BX284606 Genomic DNA Translation: CCO25890.1
BX284606 Genomic DNA Translation: CCO25891.1
BX284606 Genomic DNA Translation: CCU83306.1
BX284606 Genomic DNA Translation: CCU83365.1
PIRiD89610
T19040
T19041
T19042
T19043
T19045
T19046
T37279
T37300
T37302
T37304
RefSeqiNP_001033580.1, NM_001038491.3 [Q8MLZ5-9]
NP_001123198.1, NM_001129726.1 [Q8MLZ5-10]
NP_001294843.1, NM_001307914.1 [Q8MLZ5-12]
NP_001294845.1, NM_001307916.1 [Q8MLZ5-11]
NP_509594.3, NM_077193.4 [Q8MLZ5-1]
NP_509595.1, NM_077194.3 [Q8MLZ5-2]
NP_509596.1, NM_077195.4 [Q8MLZ5-3]
NP_509597.1, NM_077196.3 [Q8MLZ5-4]
NP_509598.1, NM_077197.3 [Q8MLZ5-5]
NP_509599.1, NM_077198.3 [Q8MLZ5-6]
NP_741873.1, NM_171753.3 [Q8MLZ5-8]
NP_741874.1, NM_171754.3 [Q8MLZ5-7]
UniGeneiCel.5023

Genome annotation databases

EnsemblMetazoaiZK899.8a; ZK899.8a; WBGene00001516 [Q8MLZ5-1]
ZK899.8b; ZK899.8b; WBGene00001516 [Q8MLZ5-2]
ZK899.8c; ZK899.8c; WBGene00001516 [Q8MLZ5-3]
ZK899.8d; ZK899.8d; WBGene00001516 [Q8MLZ5-4]
ZK899.8e; ZK899.8e; WBGene00001516 [Q8MLZ5-5]
ZK899.8f; ZK899.8f; WBGene00001516 [Q8MLZ5-6]
ZK899.8g; ZK899.8g; WBGene00001516 [Q8MLZ5-7]
ZK899.8h; ZK899.8h; WBGene00001516 [Q8MLZ5-8]
ZK899.8i.1; ZK899.8i.1; WBGene00001516 [Q8MLZ5-9]
ZK899.8i.2; ZK899.8i.2; WBGene00001516 [Q8MLZ5-9]
ZK899.8j; ZK899.8j; WBGene00001516 [Q8MLZ5-10]
ZK899.8k; ZK899.8k; WBGene00001516 [Q8MLZ5-11]
ZK899.8l; ZK899.8l; WBGene00001516 [Q8MLZ5-12]
GeneIDi181172
KEGGicel:CELE_ZK899.8
UCSCiZK899.8a c. elegans

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011277 mRNA Translation: BAA24957.1
AB011278 mRNA Translation: BAA24958.1
AB011279 mRNA Translation: BAA24959.1
AB011280 mRNA Translation: BAA24960.1 Frameshift.
AB011281 mRNA Translation: BAA24961.1
AB011282 mRNA Translation: BAA24962.1 Different initiation.
AB011283 mRNA Translation: BAA24963.1
AB011284 mRNA Translation: BAA24964.1 Different initiation.
AB011285 mRNA Translation: BAA24965.1
Z37140, Z37979, Z46266 Genomic DNA Translation: CAA85503.1
Z46266 Genomic DNA Translation: CAA86414.2
BX284606 Genomic DNA Translation: CAJ30221.1
BX284606 Genomic DNA Translation: CAO78710.1
BX284606 Genomic DNA Translation: CCO25886.1
BX284606 Genomic DNA Translation: CCO25887.1
BX284606 Genomic DNA Translation: CCO25888.1
BX284606 Genomic DNA Translation: CCO25889.1
BX284606 Genomic DNA Translation: CCO25890.1
BX284606 Genomic DNA Translation: CCO25891.1
BX284606 Genomic DNA Translation: CCU83306.1
BX284606 Genomic DNA Translation: CCU83365.1
PIRiD89610
T19040
T19041
T19042
T19043
T19045
T19046
T37279
T37300
T37302
T37304
RefSeqiNP_001033580.1, NM_001038491.3 [Q8MLZ5-9]
NP_001123198.1, NM_001129726.1 [Q8MLZ5-10]
NP_001294843.1, NM_001307914.1 [Q8MLZ5-12]
NP_001294845.1, NM_001307916.1 [Q8MLZ5-11]
NP_509594.3, NM_077193.4 [Q8MLZ5-1]
NP_509595.1, NM_077194.3 [Q8MLZ5-2]
NP_509596.1, NM_077195.4 [Q8MLZ5-3]
NP_509597.1, NM_077196.3 [Q8MLZ5-4]
NP_509598.1, NM_077197.3 [Q8MLZ5-5]
NP_509599.1, NM_077198.3 [Q8MLZ5-6]
NP_741873.1, NM_171753.3 [Q8MLZ5-8]
NP_741874.1, NM_171754.3 [Q8MLZ5-7]
UniGeneiCel.5023

3D structure databases

ProteinModelPortaliQ8MLZ5
SMRiQ8MLZ5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi46088, 1 interactor
IntActiQ8MLZ5, 1 interactor
STRINGi6239.ZK899.8c

Proteomic databases

PaxDbiQ8MLZ5
PeptideAtlasiQ8MLZ5
PRIDEiQ8MLZ5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiZK899.8a; ZK899.8a; WBGene00001516 [Q8MLZ5-1]
ZK899.8b; ZK899.8b; WBGene00001516 [Q8MLZ5-2]
ZK899.8c; ZK899.8c; WBGene00001516 [Q8MLZ5-3]
ZK899.8d; ZK899.8d; WBGene00001516 [Q8MLZ5-4]
ZK899.8e; ZK899.8e; WBGene00001516 [Q8MLZ5-5]
ZK899.8f; ZK899.8f; WBGene00001516 [Q8MLZ5-6]
ZK899.8g; ZK899.8g; WBGene00001516 [Q8MLZ5-7]
ZK899.8h; ZK899.8h; WBGene00001516 [Q8MLZ5-8]
ZK899.8i.1; ZK899.8i.1; WBGene00001516 [Q8MLZ5-9]
ZK899.8i.2; ZK899.8i.2; WBGene00001516 [Q8MLZ5-9]
ZK899.8j; ZK899.8j; WBGene00001516 [Q8MLZ5-10]
ZK899.8k; ZK899.8k; WBGene00001516 [Q8MLZ5-11]
ZK899.8l; ZK899.8l; WBGene00001516 [Q8MLZ5-12]
GeneIDi181172
KEGGicel:CELE_ZK899.8
UCSCiZK899.8a c. elegans

Organism-specific databases

CTDi181172
WormBaseiZK899.8a ; CE23470 ; WBGene00001516 ; gap-2
ZK899.8b ; CE23471 ; WBGene00001516 ; gap-2
ZK899.8c ; CE23472 ; WBGene00001516 ; gap-2
ZK899.8d ; CE23473 ; WBGene00001516 ; gap-2
ZK899.8e ; CE23474 ; WBGene00001516 ; gap-2
ZK899.8f ; CE23475 ; WBGene00001516 ; gap-2
ZK899.8g ; CE28277 ; WBGene00001516 ; gap-2
ZK899.8h ; CE31677 ; WBGene00001516 ; gap-2
ZK899.8i ; CE39119 ; WBGene00001516 ; gap-2
ZK899.8j ; CE23476 ; WBGene00001516 ; gap-2
ZK899.8k ; CE48260 ; WBGene00001516 ; gap-2
ZK899.8l ; CE48295 ; WBGene00001516 ; gap-2

Phylogenomic databases

eggNOGiKOG3508 Eukaryota
ENOG410XPU1 LUCA
GeneTreeiENSGT00760000119092
HOGENOMiHOG000000696
InParanoidiQ8MLZ5
OMAiITGPHTI
OrthoDBiEOG091G05TS
PhylomeDBiQ8MLZ5

Enzyme and pathway databases

ReactomeiR-CEL-5658442 Regulation of RAS by GAPs

Miscellaneous databases

PROiPR:Q8MLZ5

Gene expression databases

BgeeiWBGene00001516 Expressed in 7 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

Family and domain databases

Gene3Di2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001849 PH_domain
IPR039360 Ras_GTPase
IPR023152 RasGAP_CS
IPR001936 RasGAP_dom
IPR008936 Rho_GTPase_activation_prot
PANTHERiPTHR10194 PTHR10194, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF00616 RasGAP, 2 hits
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00233 PH, 1 hit
SM00323 RasGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS00509 RAS_GTPASE_ACTIV_1, 1 hit
PS50018 RAS_GTPASE_ACTIV_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGAP2_CAEEL
AccessioniPrimary (citable) accession number: Q8MLZ5
Secondary accession number(s): A6ZJ45
, K8ERX6, K8ERY0, K8ESF6, K8ESL7, K8F7Z7, K8FE04, M1ZJ21, M1ZMJ4, O44239, O44240, O44241, O44242, O44243, O44244, O44245, Q3S1K5, Q9TVD9, Q9TVE0, Q9TVE1, Q9TVE2, Q9TVE3, Q9TVE4, Q9U991, Q9UAH9, Q9UAI0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: July 19, 2003
Last modified: November 7, 2018
This is version 119 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again