Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (13 Feb 2019)
Sequence version 2 (19 Jul 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ras GTPase-activating protein gap-2

Gene

gap-2

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase-activating protein, which acts as a negative regulator for the member of the Ras family let-60. Probably decreases the signaling activity of Ras by stimulating its intinsic GTPase activity, thereby lowering the levels of GTP-bound, active Ras. The different isoforms may play a distinct role in specific tissues.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: UniProtKB

GO - Biological processi

  • associative learning Source: WormBase
  • long-term memory Source: WormBase
  • negative regulation of Ras protein signal transduction Source: UniProtKB
  • short-term memory Source: WormBase
  • signal transduction Source: InterPro

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras GTPase-activating protein gap-2
Short name:
GTPase-activating protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:gap-2
ORF Names:ZK899.8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

WormBase

More...
WormBasei
ZK899.8a ; CE23470 ; WBGene00001516 ; gap-2
ZK899.8b ; CE23471 ; WBGene00001516 ; gap-2
ZK899.8c ; CE23472 ; WBGene00001516 ; gap-2
ZK899.8d ; CE23473 ; WBGene00001516 ; gap-2
ZK899.8e ; CE23474 ; WBGene00001516 ; gap-2
ZK899.8f ; CE23475 ; WBGene00001516 ; gap-2
ZK899.8g ; CE28277 ; WBGene00001516 ; gap-2
ZK899.8h ; CE31677 ; WBGene00001516 ; gap-2
ZK899.8i ; CE39119 ; WBGene00001516 ; gap-2
ZK899.8j ; CE23476 ; WBGene00001516 ; gap-2
ZK899.8k ; CE48260 ; WBGene00001516 ; gap-2
ZK899.8l ; CE48295 ; WBGene00001516 ; gap-2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000566641 – 1207Ras GTPase-activating protein gap-2Add BLAST1207

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8MLZ5

PeptideAtlas

More...
PeptideAtlasi
Q8MLZ5

PRoteomics IDEntifications database

More...
PRIDEi
Q8MLZ5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Mainly expressed in gonads and vulval cells. Isoform c in expressed in pharyngeal epithelial cells and several rectal/blast cells in the tail region. Isoform f is weakly expressed in four cells symmetrically located in the vulval region. Isoform g is strongly expressed in the pharyngeal muscle cells m6 in addition to several cells in the tail region.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00001516 Expressed in 7 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
46088, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q8MLZ5, 1 interactor

STRING: functional protein association networks

More...
STRINGi
6239.ZK899.8c

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8MLZ5

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8MLZ5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 383PHAdd BLAST344
Domaini395 – 474C2Add BLAST80
Domaini563 – 757Ras-GAPPROSITE-ProRule annotationAdd BLAST195

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi986 – 1014Ser-richAdd BLAST29

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3508 Eukaryota
ENOG410XPU1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000172132

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000000696

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8MLZ5

Identification of Orthologs from Complete Genome Data

More...
OMAi
ITGPHTI

Database of Orthologous Groups

More...
OrthoDBi
69536at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8MLZ5

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001849 PH_domain
IPR039360 Ras_GTPase
IPR023152 RasGAP_CS
IPR001936 RasGAP_dom
IPR008936 Rho_GTPase_activation_prot

The PANTHER Classification System

More...
PANTHERi
PTHR10194 PTHR10194, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168 C2, 1 hit
PF00616 RasGAP, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239 C2, 1 hit
SM00233 PH, 1 hit
SM00323 RasGAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350 SSF48350, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00509 RAS_GTPASE_ACTIV_1, 1 hit
PS50018 RAS_GTPASE_ACTIV_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 12 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform aImported (identifier: Q8MLZ5-1) [UniParc]FASTAAdd to basket
Also known as: GAP-2-11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKVIDEKPED EEEEKDSGSK CKTPSSCTKK RVREKEEDLP PICHGWLIVC
60 70 80 90 100
EGNPTKMMNK EVKLPWHAGY CVFEPRQSTM SCYKQEYPFI AGRMLHRNRT
110 120 130 140 150
VRMDGDRSAF ARHWGLLPEH YPSPPITGPH TIARSYTRPP KDRLPTKERF
160 170 180 190 200
FSISRIPSRL TKFSTVRGMS IEFFDAIHDE TNSGGAQVGG ESLDRRGWSG
210 220 230 240 250
ASTGNRTTLT ASVHNNLMNG RMSSSSHNLS TRLSGSTQNL NQPTNAYGNL
260 270 280 290 300
LSRPFRSNPL KRTKSVSKME KSLAEANQHS LHRVDASNTP SRDSSLYAQP
310 320 330 340 350
PARRHLSQPA REGSLRACRS HESLLSSAHS THMIELNEDN RLHPVHPSIF
360 370 380 390 400
EVPNCFRLAS TYYSCRTPLE RAKWMENLRK TMNPRRDQQR RTENSMLIWI
410 420 430 440 450
LEAKGLPAKR KYYCEMTLDK TLYAKTSSKA RTDNVFWGEN FEFMMLPKID
460 470 480 490 500
EVCVSLFRES DSKKKKDTLI GYVTIGIDQL SSRSPVERWY TVNTSHSDSG
510 520 530 540 550
TSRIASALGG KSSSQESPSL RIKARWQSVH ILPLRAYDNL LETLCYNYLP
560 570 580 590 600
LCEQLEPVLN VRDKEDLATS LVRVMYKHNL AKEFLCDLIM KEVEKLDNDH
610 620 630 640 650
LMFRGNTLAT KAMESFMKLV ADDYLDSTLS DFIKTVLQCE DSCEVDPQKL
660 670 680 690 700
GNVSNSSLEK NRALLMRYVE VAWTKILNNV HQLPKNLRDV FSALRCRLEA
710 720 730 740 750
QNREALADTL ISSSIFLRFL CPAILSPSLF NLVSEYPSPT NARNLTLIAK
760 770 780 790 800
TLQNLANFSK FGGKEPHMEF MNEFVDREWH RMKDFLLRIS SESKSGPEKN
810 820 830 840 850
ADAIVDAGKE LSLIATYLEE AWTPLLQEKN GNKHPLSNVK SVLSELAECK
860 870 880 890 900
RRSDNGVFHS PMVQQPSSDY ENSPQQHVVP RHENVPAYRS TPPTGQATVL
910 920 930 940 950
GRSTNRPATH LLTSDDYVLS SAFQTPSLRP GGTRLSDETG TSSSRTSDKT
960 970 980 990 1000
TSSAEIRDDT DSDFELREDR GRGGRNRKRL PRTDASPSSS QQASSGYLSN
1010 1020 1030 1040 1050
NPSRSSYSNS SSSSPVERMA ALSIANPVFG PGPSSGYAIP AEPKEIVYQK
1060 1070 1080 1090 1100
RASPPPYDPD VHNYHYQPMQ VYAVPPDCQV SPRTQATGGV NAQNRLSLPR
1110 1120 1130 1140 1150
TNPRASRNST LLRPSVVNVP DDWDRTSDYW RDRGENNYRS QLESQVESQA
1160 1170 1180 1190 1200
REIERLMREN IELKSKMMSS TKTVDSKRSD SGASEDSYDS LSSLDRPSRQ

SLVVVPN
Length:1,207
Mass (Da):136,247
Last modified:July 19, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEA222578D689795F
GO
Isoform bImported (identifier: Q8MLZ5-2) [UniParc]FASTAAdd to basket
Also known as: GAP-2-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: Missing.
     248-248: G → GFPIVPPANNPSDSSASGRIA

Show »
Length:1,170
Mass (Da):131,725
Checksum:i858EDFFC58E6F542
GO
Isoform cImported (identifier: Q8MLZ5-3) [UniParc]FASTAAdd to basket
Also known as: GAP-2-31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MKVIDEKPED...TVRGMSIEFF → MHRQGVHPNA...VPSTLSLVIH
     248-248: G → GFPIVPPANNPSDSSASGRIA

Show »
Length:1,259
Mass (Da):141,210
Checksum:iD1ECF8EC9F11A3D7
GO
Isoform dImported (identifier: Q8MLZ5-4) [UniParc]FASTAAdd to basket
Also known as: GAP-2-41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     91-174: AGRMLHRNRT...TVRGMSIEFF → MHTPSPIPQE...VPSTLSLVIH
     248-248: G → GFPIVPPANNPSDSSASGRIA

Show »
Length:1,137
Mass (Da):127,824
Checksum:i3A965BC479150CEC
GO
Isoform eImported (identifier: Q8MLZ5-5) [UniParc]FASTAAdd to basket
Also known as: GAP-2-51 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-174: LTKFSTVRGMSIEFF → METFDIRPSKYGSVR

Show »
Length:1,048
Mass (Da):117,743
Checksum:iB2CC4D066C2AC32F
GO
Isoform fImported (identifier: Q8MLZ5-6) [UniParc]FASTAAdd to basket
Also known as: GAP-2-71 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-251: Missing.
     252-279: SRPFRSNPLKRTKSVSKMEKSLAEANQH → MQCLSPNREKHNANPRLVRGRIVYKSKR

Show »
Length:956
Mass (Da):108,072
Checksum:i5D769A8BFF0EE3E0
GO
Isoform gImported (identifier: Q8MLZ5-7) [UniParc]FASTAAdd to basket
Also known as: GAP-2-91 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-420: Missing.
     421-489: TLYAKTSSKA...LSSRSPVERW → MRGEYDPWDP...YVRVSSLFGE

Show »
Length:787
Mass (Da):88,435
Checksum:i97308CC5FC21A874
GO
Isoform h (identifier: Q8MLZ5-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     120-174: HYPSPPITGP...TVRGMSIEFF → MRRYGISPWYSQSTYSLNIIPEEYVPPVDYDIDFR
     248-248: G → GFPIVPPANNPSDSSASGRIA

Note: No experimental confirmation available.Curated
Show »
Length:1,088
Mass (Da):122,208
Checksum:iE06432F9BA7B9918
GO
Isoform iImported (identifier: Q8MLZ5-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-381: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:826
Mass (Da):93,047
Checksum:iCD841465F45A093D
GO
Isoform jImported (identifier: Q8MLZ5-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-489: MKVIDEKPED...LSSRSPVERW → MRGEYDPWDP...VSSLFGEYCR

Note: No experimental confirmation available.Curated
Show »
Length:790
Mass (Da):88,857
Checksum:i2B7C7B7C856BEDFF
GO
Isoform kImported (identifier: Q8MLZ5-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1069-1070: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,205
Mass (Da):135,988
Checksum:iE11AA30F518837B5
GO
Isoform lImported (identifier: Q8MLZ5-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-279: MKVIDEKPED...EKSLAEANQH → MKHMFSIRSSSYTVNIPNQP

Note: No experimental confirmation available.Curated
Show »
Length:948
Mass (Da):107,058
Checksum:i0E3862DF2932E6A2
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA24960 differs from that shown. Reason: Frameshift at position 1097.Curated
The sequence BAA24962 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA24964 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1028V → C in BAA24960 (PubMed:9619631).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0582831 – 489MKVID…PVERW → MRGEYDPWDPSFHNSSMIPY SLASIYPSIENLPEEFSNEN NKIKNVLKNFIWSFKLKKNY VRVSSLFGEYCR in isoform j. CuratedAdd BLAST489
Alternative sequenceiVSP_0077971 – 420Missing in isoform g. CuratedAdd BLAST420
Alternative sequenceiVSP_0582841 – 381Missing in isoform i. Add BLAST381
Alternative sequenceiVSP_0582851 – 279MKVID…EANQH → MKHMFSIRSSSYTVNIPNQP in isoform l. CuratedAdd BLAST279
Alternative sequenceiVSP_0077951 – 251Missing in isoform f. CuratedAdd BLAST251
Alternative sequenceiVSP_0077901 – 174MKVID…SIEFF → MHRQGVHPNALHHLLLANKK RSNTTTCAHSTSSTPRSTYS SGSATSSLPLYVNTHAVTEQ PKAEKRVSFKDLDMSGRLPV TAQQPSSSSNHLRTGGGLHA RKLHRCDTGNMSLLERYLSR ENMHTPSPIPQEYQPQANYS SRHVHFAQSQSRRPFQRDQR NENASIRKRLSRSCDHLSDH NFSPRLPPIRRKPTKHVPST LSLVIH in isoform c. CuratedAdd BLAST174
Alternative sequenceiVSP_0077931 – 159Missing in isoform e. CuratedAdd BLAST159
Alternative sequenceiVSP_0077991 – 119Missing in isoform h. CuratedAdd BLAST119
Alternative sequenceiVSP_0077911 – 90Missing in isoform d. 1 PublicationAdd BLAST90
Alternative sequenceiVSP_0077881 – 57Missing in isoform b. CuratedAdd BLAST57
Alternative sequenceiVSP_00779291 – 174AGRML…SIEFF → MHTPSPIPQEYQPQANYSSR HVHFAQSQSRRPFQRDQRNE NASIRKRLSRSCDHLSDHNF SPRLPPIRRKPTKHVPSTLS LVIH in isoform d. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_007800120 – 174HYPSP…SIEFF → MRRYGISPWYSQSTYSLNII PEEYVPPVDYDIDFR in isoform h. CuratedAdd BLAST55
Alternative sequenceiVSP_007794160 – 174LTKFS…SIEFF → METFDIRPSKYGSVR in isoform e. CuratedAdd BLAST15
Alternative sequenceiVSP_007789248G → GFPIVPPANNPSDSSASGRI A in isoform b, isoform c, isoform d and isoform h. 1 Publication1
Alternative sequenceiVSP_007796252 – 279SRPFR…EANQH → MQCLSPNREKHNANPRLVRG RIVYKSKR in isoform f. CuratedAdd BLAST28
Alternative sequenceiVSP_007798421 – 489TLYAK…PVERW → MRGEYDPWDPSFHNSSMIPY SLASIYPSIENLPEEFSNEN NKIKNVLKNFIWSFKLKKNY VRVSSLFGE in isoform g. CuratedAdd BLAST69
Alternative sequenceiVSP_0582861069 – 1070Missing in isoform k. Curated2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB011277 mRNA Translation: BAA24957.1
AB011278 mRNA Translation: BAA24958.1
AB011279 mRNA Translation: BAA24959.1
AB011280 mRNA Translation: BAA24960.1 Frameshift.
AB011281 mRNA Translation: BAA24961.1
AB011282 mRNA Translation: BAA24962.1 Different initiation.
AB011283 mRNA Translation: BAA24963.1
AB011284 mRNA Translation: BAA24964.1 Different initiation.
AB011285 mRNA Translation: BAA24965.1
Z37140, Z37979, Z46266 Genomic DNA Translation: CAA85503.1
Z46266 Genomic DNA Translation: CAA86414.2
BX284606 Genomic DNA Translation: CAJ30221.1
BX284606 Genomic DNA Translation: CAO78710.1
BX284606 Genomic DNA Translation: CCO25886.1
BX284606 Genomic DNA Translation: CCO25887.1
BX284606 Genomic DNA Translation: CCO25888.1
BX284606 Genomic DNA Translation: CCO25889.1
BX284606 Genomic DNA Translation: CCO25890.1
BX284606 Genomic DNA Translation: CCO25891.1
BX284606 Genomic DNA Translation: CCU83306.1
BX284606 Genomic DNA Translation: CCU83365.1

Protein sequence database of the Protein Information Resource

More...
PIRi
D89610
T19040
T19041
T19042
T19043
T19045
T19046
T37279
T37300
T37302
T37304

NCBI Reference Sequences

More...
RefSeqi
NP_001033580.1, NM_001038491.3 [Q8MLZ5-9]
NP_001123198.1, NM_001129726.1 [Q8MLZ5-10]
NP_001294843.1, NM_001307914.1 [Q8MLZ5-12]
NP_001294845.1, NM_001307916.1 [Q8MLZ5-11]
NP_509594.3, NM_077193.4 [Q8MLZ5-1]
NP_509595.1, NM_077194.3 [Q8MLZ5-2]
NP_509596.1, NM_077195.4 [Q8MLZ5-3]
NP_509597.1, NM_077196.3 [Q8MLZ5-4]
NP_509598.1, NM_077197.3 [Q8MLZ5-5]
NP_509599.1, NM_077198.3 [Q8MLZ5-6]
NP_741873.1, NM_171753.3 [Q8MLZ5-8]
NP_741874.1, NM_171754.3 [Q8MLZ5-7]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Cel.5023

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
ZK899.8a; ZK899.8a; WBGene00001516 [Q8MLZ5-1]
ZK899.8b; ZK899.8b; WBGene00001516 [Q8MLZ5-2]
ZK899.8c; ZK899.8c; WBGene00001516 [Q8MLZ5-3]
ZK899.8d; ZK899.8d; WBGene00001516 [Q8MLZ5-4]
ZK899.8e; ZK899.8e; WBGene00001516 [Q8MLZ5-5]
ZK899.8f; ZK899.8f; WBGene00001516 [Q8MLZ5-6]
ZK899.8g; ZK899.8g; WBGene00001516 [Q8MLZ5-7]
ZK899.8h; ZK899.8h; WBGene00001516 [Q8MLZ5-8]
ZK899.8i.1; ZK899.8i.1; WBGene00001516 [Q8MLZ5-9]
ZK899.8i.2; ZK899.8i.2; WBGene00001516 [Q8MLZ5-9]
ZK899.8j; ZK899.8j; WBGene00001516 [Q8MLZ5-10]
ZK899.8k; ZK899.8k; WBGene00001516 [Q8MLZ5-11]
ZK899.8l; ZK899.8l; WBGene00001516 [Q8MLZ5-12]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
181172

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_ZK899.8

UCSC genome browser

More...
UCSCi
ZK899.8a c. elegans

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011277 mRNA Translation: BAA24957.1
AB011278 mRNA Translation: BAA24958.1
AB011279 mRNA Translation: BAA24959.1
AB011280 mRNA Translation: BAA24960.1 Frameshift.
AB011281 mRNA Translation: BAA24961.1
AB011282 mRNA Translation: BAA24962.1 Different initiation.
AB011283 mRNA Translation: BAA24963.1
AB011284 mRNA Translation: BAA24964.1 Different initiation.
AB011285 mRNA Translation: BAA24965.1
Z37140, Z37979, Z46266 Genomic DNA Translation: CAA85503.1
Z46266 Genomic DNA Translation: CAA86414.2
BX284606 Genomic DNA Translation: CAJ30221.1
BX284606 Genomic DNA Translation: CAO78710.1
BX284606 Genomic DNA Translation: CCO25886.1
BX284606 Genomic DNA Translation: CCO25887.1
BX284606 Genomic DNA Translation: CCO25888.1
BX284606 Genomic DNA Translation: CCO25889.1
BX284606 Genomic DNA Translation: CCO25890.1
BX284606 Genomic DNA Translation: CCO25891.1
BX284606 Genomic DNA Translation: CCU83306.1
BX284606 Genomic DNA Translation: CCU83365.1
PIRiD89610
T19040
T19041
T19042
T19043
T19045
T19046
T37279
T37300
T37302
T37304
RefSeqiNP_001033580.1, NM_001038491.3 [Q8MLZ5-9]
NP_001123198.1, NM_001129726.1 [Q8MLZ5-10]
NP_001294843.1, NM_001307914.1 [Q8MLZ5-12]
NP_001294845.1, NM_001307916.1 [Q8MLZ5-11]
NP_509594.3, NM_077193.4 [Q8MLZ5-1]
NP_509595.1, NM_077194.3 [Q8MLZ5-2]
NP_509596.1, NM_077195.4 [Q8MLZ5-3]
NP_509597.1, NM_077196.3 [Q8MLZ5-4]
NP_509598.1, NM_077197.3 [Q8MLZ5-5]
NP_509599.1, NM_077198.3 [Q8MLZ5-6]
NP_741873.1, NM_171753.3 [Q8MLZ5-8]
NP_741874.1, NM_171754.3 [Q8MLZ5-7]
UniGeneiCel.5023

3D structure databases

ProteinModelPortaliQ8MLZ5
SMRiQ8MLZ5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi46088, 1 interactor
IntActiQ8MLZ5, 1 interactor
STRINGi6239.ZK899.8c

Proteomic databases

PaxDbiQ8MLZ5
PeptideAtlasiQ8MLZ5
PRIDEiQ8MLZ5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiZK899.8a; ZK899.8a; WBGene00001516 [Q8MLZ5-1]
ZK899.8b; ZK899.8b; WBGene00001516 [Q8MLZ5-2]
ZK899.8c; ZK899.8c; WBGene00001516 [Q8MLZ5-3]
ZK899.8d; ZK899.8d; WBGene00001516 [Q8MLZ5-4]
ZK899.8e; ZK899.8e; WBGene00001516 [Q8MLZ5-5]
ZK899.8f; ZK899.8f; WBGene00001516 [Q8MLZ5-6]
ZK899.8g; ZK899.8g; WBGene00001516 [Q8MLZ5-7]
ZK899.8h; ZK899.8h; WBGene00001516 [Q8MLZ5-8]
ZK899.8i.1; ZK899.8i.1; WBGene00001516 [Q8MLZ5-9]
ZK899.8i.2; ZK899.8i.2; WBGene00001516 [Q8MLZ5-9]
ZK899.8j; ZK899.8j; WBGene00001516 [Q8MLZ5-10]
ZK899.8k; ZK899.8k; WBGene00001516 [Q8MLZ5-11]
ZK899.8l; ZK899.8l; WBGene00001516 [Q8MLZ5-12]
GeneIDi181172
KEGGicel:CELE_ZK899.8
UCSCiZK899.8a c. elegans

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
181172
WormBaseiZK899.8a ; CE23470 ; WBGene00001516 ; gap-2
ZK899.8b ; CE23471 ; WBGene00001516 ; gap-2
ZK899.8c ; CE23472 ; WBGene00001516 ; gap-2
ZK899.8d ; CE23473 ; WBGene00001516 ; gap-2
ZK899.8e ; CE23474 ; WBGene00001516 ; gap-2
ZK899.8f ; CE23475 ; WBGene00001516 ; gap-2
ZK899.8g ; CE28277 ; WBGene00001516 ; gap-2
ZK899.8h ; CE31677 ; WBGene00001516 ; gap-2
ZK899.8i ; CE39119 ; WBGene00001516 ; gap-2
ZK899.8j ; CE23476 ; WBGene00001516 ; gap-2
ZK899.8k ; CE48260 ; WBGene00001516 ; gap-2
ZK899.8l ; CE48295 ; WBGene00001516 ; gap-2

Phylogenomic databases

eggNOGiKOG3508 Eukaryota
ENOG410XPU1 LUCA
GeneTreeiENSGT00940000172132
HOGENOMiHOG000000696
InParanoidiQ8MLZ5
OMAiITGPHTI
OrthoDBi69536at2759
PhylomeDBiQ8MLZ5

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8MLZ5

Gene expression databases

BgeeiWBGene00001516 Expressed in 7 organ(s), highest expression level in pharyngeal muscle cell (C elegans)

Family and domain databases

Gene3Di2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR001849 PH_domain
IPR039360 Ras_GTPase
IPR023152 RasGAP_CS
IPR001936 RasGAP_dom
IPR008936 Rho_GTPase_activation_prot
PANTHERiPTHR10194 PTHR10194, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF00616 RasGAP, 2 hits
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00233 PH, 1 hit
SM00323 RasGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS00509 RAS_GTPASE_ACTIV_1, 1 hit
PS50018 RAS_GTPASE_ACTIV_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGAP2_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8MLZ5
Secondary accession number(s): A6ZJ45
, K8ERX6, K8ERY0, K8ESF6, K8ESL7, K8F7Z7, K8FE04, M1ZJ21, M1ZMJ4, O44239, O44240, O44241, O44242, O44243, O44244, O44245, Q3S1K5, Q9TVD9, Q9TVE0, Q9TVE1, Q9TVE2, Q9TVE3, Q9TVE4, Q9U991, Q9UAH9, Q9UAI0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: July 19, 2003
Last modified: February 13, 2019
This is version 122 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again