Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8K3W0 (BABA2_MOUSE)

Entry version 134 (16 Oct 2019)
Sequence version 2 (05 May 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

BRISC and BRCA1-A complex member 2

Gene

Babam2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity and modulating the E3 ubiquitin ligase activity of the BRCA1-BARD1 heterodimer. Probably also plays a role as a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin (By similarity). May regulate TNF-alpha signaling through its interactions with TNFRSF1A.By similarity1 Publication
Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity and modulating the E3 ubiquitin ligase activity of the BRCA1-BARD1 heterodimer. Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Within the BRISC complex, acts as an adapter that bridges the interaction between BABAM1/NBA1 and the rest of the complex, thereby being required for the complex integrity. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1. The BRISC complex plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression. Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination. May play a role in homeostasis or cellular differentiation in cells of neural, epithelial and germline origins (By similarity). May also act as a death receptor-associated anti-apoptotic protein, which inhibits the mitochondrial apoptotic pathway. May regulate TNF-alpha signaling through its interactions with TNFRSF1A; however these effects may be indirect (PubMed:9737713).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator
Biological processApoptosis, Cell cycle, Cell division, DNA damage, DNA repair, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-5689901 Metalloprotease DUBs
R-MMU-5693565 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
R-MMU-5693571 Nonhomologous End-Joining (NHEJ)
R-MMU-5693607 Processing of DNA double-strand break ends
R-MMU-69473 G2/M DNA damage checkpoint

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
BRISC and BRCA1-A complex member 2
Alternative name(s):
BRCA1-A complex subunit BRE
BRCA1/BRCA2-containing complex subunit 45
Brain and reproductive organ-expressed protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Babam2
Synonyms:BreImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1333875 Babam2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002241901 – 383BRISC and BRCA1-A complex member 2Add BLAST383

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei2PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8K3W0

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8K3W0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8K3W0

PeptideAtlas

More...PeptideAtlasi		Q8K3W0

PRoteomics IDEntifications database

More...PRIDEi		Q8K3W0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8K3W0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8K3W0

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8K3W0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, heart, kidney, liver, lung, testis, germinal center B-cells and various mouse cell lines.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000052139 Expressed in 284 organ(s), highest expression level in female gonad

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8K3W0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8K3W0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the ARISC complex, at least composed of UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1.

Component of the BRCA1-A complex, at least composed of BRCA1, BARD1, UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with ABRAXAS1, BRCC3/BRCC36 and BABAM1/NBA1. Binds polyubiquitin.

Component of the BRISC complex, at least composed of ABRAXAS2, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1.

Identified in a complex with SHMT2 and the other subunits of the BRISC complex.

Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRCC3/BRCC36 and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. May interact with FAS and TNFRSF1A (PubMed:9737713).

By similarity1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		223733, 4 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-972 BRCC ubiquitin ligase complex

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8K3W0

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni30 – 147UEV-like 1Add BLAST118
Regioni275 – 364UEV-like 2Add BLAST90

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains 2 ubiquitin-conjugating enzyme family-like (UEV-like) regions. These regions lack the critical Cys residues required for ubiquitination but retain the ability to bind ubiquitin (By similarity).By similarity
Contains 2 ubiquitin-conjugating enzyme family-like (UEV-like) regions. These regions lack the critical Cys residues required for ubiquitination but retain the ability to bind ubiquitin.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BABAM2 family.Sequence analysis

Keywords - Domaini

Repeat

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00390000004208

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8K3W0

KEGG Orthology (KO)

More...KOi		K12173

Identification of Orthologs from Complete Genome Data

More...OMAi		LVQWDAG

Database of Orthologous Groups

More...OrthoDBi		831092at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8K3W0

TreeFam database of animal gene trees

More...TreeFami		TF328507

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR010358 BRE

The PANTHER Classification System

More...PANTHERi		PTHR15189 PTHR15189, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF06113 BRE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms may exist.Curated

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 21 Publication (identifier: Q8K3W0-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPEIALNRI SPMLSPFISS VVRNGKVGLD ATNCLRITDL KSGCTSLTPG 
        60         70         80         90        100
PNCDRFKLHI PYAGETLKWD IIFNAQYPEL PPDFIFGEDA EFLPDPSALH 
       110        120        130        140        150
NLASWNPSNP ECLLLVVKEL VQQYHQFQCG RLRESSRLMF EYQTLLEEPQ 
       160        170        180        190        200
YGENMEIYAG KKNNWTGEFS ARFLLKLPVD FSNIPTYLLK DVNEDPGEDV 
       210        220        230        240        250
ALLSVSFEDT EATQVYPKLY LSPRIEHALG GSSALHIPAF PGGGCLIDYV 
       260        270        280        290        300
PQVCHLLTNK VQYVIQGYHK RREYIAAFLS HFGTGVVEYD AEGFTKLTLL 
       310        320        330        340        350
LMWKDFCFLV HIDLPLFFPR DQPTLTFQSV YHFTNSGQLY SQAQKNYPYS 
       360        370        380 
PRWDGNEMAK RAKAYFKTFV PQFQEAAFAN GKL
Length:383
Mass (Da):43,545
Last modified:May 5, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7BABA837A8AF82E6
GO
Isoform 11 Publication (identifier: Q8K3W0-1) [UniParc]FASTAAdd to basket
Also known as: I1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     27-43: VGLDATNCLRITDLKSG → IHEKGPSQKLSFKSCSYHLPMCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN

Show »
Length:420
Mass (Da):48,089
Checksum:i1A9D634D162CE2A8
GO
Isoform 3 (identifier: Q8K3W0-4) [UniParc]FASTAAdd to basket
Also known as: II, II3+

The sequence of this isoform differs from the canonical sequence as follows:
     1-138: Missing.

Show »
Length:245
Mass (Da):28,090
Checksum:i2F77E99B644BD4B4
GO
Isoform 4 (identifier: Q8K3W0-5) [UniParc]FASTAAdd to basket
Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSPEIALNRI...CLRITDLKSG → MCACNEWYGVPDLEKASYLWRKKENHLPLEKGQN

Show »
Length:374
Mass (Da):42,994
Checksum:i6A60137DAF657C78
GO
Isoform 5 (identifier: Q8K3W0-6) [UniParc]FASTAAdd to basket
Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKW → MCACR

Show »
Length:319
Mass (Da):36,595
Checksum:i2AE2865E15A82E37
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z7P0D3Z7P0_MOUSE
BRISC and BRCA1-A complex member 2
Babam2 Bre
385Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q8Q1E9Q8Q1_MOUSE
BRISC and BRCA1-A complex member 2
Babam2 Bre
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q0U3E9Q0U3_MOUSE
BRISC and BRCA1-A complex member 2
Babam2 Bre
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YV56A0A0J9YV56_MOUSE
BRISC and BRCA1-A complex member 2
Babam2 Bre
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC34385 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti105W → R in AAH61000 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0519521 – 138Missing in isoform 3. 1 PublicationAdd BLAST138
Alternative sequenceiVSP_0372621 – 69MSPEI…ETLKW → MCACR in isoform 5. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_0372631 – 43MSPEI…DLKSG → MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_05195327 – 43VGLDA…DLKSG → IHEKGPSQKLSFKSCSYHLP MCACNEWYGVPDLEKASYLW RKKENHLPLEKGQN in isoform 1. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF440752 mRNA Translation: AAL40809.1
AF527952 mRNA Translation: AAM92774.1
AF527953 mRNA Translation: AAM92775.1
AF527954 mRNA Translation: AAM92776.1
AF527955 mRNA Translation: AAM92777.1
AF538925 mRNA Translation: AAN15148.1
AK050695 mRNA Translation: BAC34385.1 Sequence problems.
AK080991 mRNA Translation: BAC38108.1
AK156929 mRNA Translation: BAE33900.1
BC061000 mRNA Translation: AAH61000.1
BC100565 mRNA Translation: AAI00566.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS19188.1 [Q8K3W0-2]
CCDS19189.1 [Q8K3W0-1]
CCDS39058.1 [Q8K3W0-5]
CCDS39059.1 [Q8K3W0-4]
CCDS51461.1 [Q8K3W0-6]

NCBI Reference Sequences

More...RefSeqi		NP_653124.1, NM_144541.1 [Q8K3W0-2]
NP_851796.1, NM_181279.1 [Q8K3W0-1]
NP_851797.1, NM_181280.1 [Q8K3W0-5]
NP_851798.1, NM_181281.1 [Q8K3W0-6]
NP_851799.1, NM_181282.1 [Q8K3W0-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000063813; ENSMUSP00000069133; ENSMUSG00000052139 [Q8K3W0-1]
ENSMUST00000071531; ENSMUSP00000071462; ENSMUSG00000052139 [Q8K3W0-5]
ENSMUST00000114507; ENSMUSP00000110152; ENSMUSG00000052139 [Q8K3W0-6]
ENSMUST00000131995; ENSMUSP00000128351; ENSMUSG00000052139 [Q8K3W0-4]
ENSMUST00000201352; ENSMUSP00000144205; ENSMUSG00000052139 [Q8K3W0-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		107976

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:107976

UCSC genome browser

More...UCSCi		uc008wza.1 mouse [Q8K3W0-2]
uc008wzb.1 mouse [Q8K3W0-1]
uc008wzc.1 mouse [Q8K3W0-5]
uc008wze.1 mouse [Q8K3W0-6]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF440752 mRNA Translation: AAL40809.1
AF527952 mRNA Translation: AAM92774.1
AF527953 mRNA Translation: AAM92775.1
AF527954 mRNA Translation: AAM92776.1
AF527955 mRNA Translation: AAM92777.1
AF538925 mRNA Translation: AAN15148.1
AK050695 mRNA Translation: BAC34385.1 Sequence problems.
AK080991 mRNA Translation: BAC38108.1
AK156929 mRNA Translation: BAE33900.1
BC061000 mRNA Translation: AAH61000.1
BC100565 mRNA Translation: AAI00566.1
CCDSiCCDS19188.1 [Q8K3W0-2]
CCDS19189.1 [Q8K3W0-1]
CCDS39058.1 [Q8K3W0-5]
CCDS39059.1 [Q8K3W0-4]
CCDS51461.1 [Q8K3W0-6]
RefSeqiNP_653124.1, NM_144541.1 [Q8K3W0-2]
NP_851796.1, NM_181279.1 [Q8K3W0-1]
NP_851797.1, NM_181280.1 [Q8K3W0-5]
NP_851798.1, NM_181281.1 [Q8K3W0-6]
NP_851799.1, NM_181282.1 [Q8K3W0-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6GVWX-ray3.75C/H1-383[»]
SMRiQ8K3W0
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi223733, 4 interactors
ComplexPortaliCPX-972 BRCC ubiquitin ligase complex

PTM databases

iPTMnetiQ8K3W0
PhosphoSitePlusiQ8K3W0
SwissPalmiQ8K3W0

Proteomic databases

EPDiQ8K3W0
jPOSTiQ8K3W0
MaxQBiQ8K3W0
PeptideAtlasiQ8K3W0
PRIDEiQ8K3W0

Genome annotation databases

EnsembliENSMUST00000063813; ENSMUSP00000069133; ENSMUSG00000052139 [Q8K3W0-1]
ENSMUST00000071531; ENSMUSP00000071462; ENSMUSG00000052139 [Q8K3W0-5]
ENSMUST00000114507; ENSMUSP00000110152; ENSMUSG00000052139 [Q8K3W0-6]
ENSMUST00000131995; ENSMUSP00000128351; ENSMUSG00000052139 [Q8K3W0-4]
ENSMUST00000201352; ENSMUSP00000144205; ENSMUSG00000052139 [Q8K3W0-2]
GeneIDi107976
KEGGimmu:107976
UCSCiuc008wza.1 mouse [Q8K3W0-2]
uc008wzb.1 mouse [Q8K3W0-1]
uc008wzc.1 mouse [Q8K3W0-5]
uc008wze.1 mouse [Q8K3W0-6]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9577
MGIiMGI:1333875 Babam2

Phylogenomic databases

GeneTreeiENSGT00390000004208
InParanoidiQ8K3W0
KOiK12173
OMAiLVQWDAG
OrthoDBi831092at2759
PhylomeDBiQ8K3W0
TreeFamiTF328507

Enzyme and pathway databases

ReactomeiR-MMU-5689901 Metalloprotease DUBs
R-MMU-5693565 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
R-MMU-5693571 Nonhomologous End-Joining (NHEJ)
R-MMU-5693607 Processing of DNA double-strand break ends
R-MMU-69473 G2/M DNA damage checkpoint

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Bre mouse

Protein Ontology

More...PROi		PR:Q8K3W0

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000052139 Expressed in 284 organ(s), highest expression level in female gonad
ExpressionAtlasiQ8K3W0 baseline and differential
GenevisibleiQ8K3W0 MM

Family and domain databases

InterProiView protein in InterPro
IPR010358 BRE
PANTHERiPTHR15189 PTHR15189, 1 hit
PfamiView protein in Pfam
PF06113 BRE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBABA2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8K3W0
Secondary accession number(s): Q497G6
, Q6P8Z2, Q8BKU1, Q8CJ13, Q8JZP0, Q8K3V9, Q8VHN1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2006
Last sequence update: May 5, 2009
Last modified: October 16, 2019
This is version 134 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again