Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (12 Aug 2020)
Sequence version 2 (02 Oct 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4

Gene

Plcd4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca2+ from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca2+ mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+By similarityNote: Binds 3 Ca2+ ions per subunit. Two of the Ca2+ ions are bound to the C2 domain.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei305PROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi306Calcium 1; catalyticBy similarity1
Metal bindingi335Calcium 1; catalyticBy similarity1
Metal bindingi337Calcium 1; catalyticBy similarity1
Active sitei350PROSITE-ProRule annotation1
Metal bindingi384Calcium 1; catalyticBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei433SubstrateBy similarity1
Binding sitei435SubstrateBy similarity1
Binding sitei567SubstrateBy similarity1
Binding sitei594SubstrateBy similarity1
Metal bindingi697Calcium 2By similarity1
Metal bindingi721Calcium 2By similarity1
Metal bindingi750Calcium 3By similarity1
Metal bindingi751Calcium 3; via carbonyl oxygenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi147 – 1581PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi183 – 1942PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1855204, Synthesis of IP3 and IP4 in the cytosol

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-delta-4
Phospholipase C-delta-4
Short name:
PLC-delta-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Plcd4
Synonyms:Plcd
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:107469, Plcd4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are either sterile or produce few small litters. In these mice, fewer eggs become activated and the Ca2+ transients associated with fertilization are absent or delayed. Sperm are unable to initiate the acrosome reaction.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003068261 – 8071-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4Add BLAST807

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8K3R3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8K3R3

PRoteomics IDEntifications database

More...
PRIDEi
Q8K3R3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8K3R3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8K3R3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By treatment with growth factors such as bradykinin, lysophosphatidic acid, and Ca2+ ionophore in addition to serum.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000026173, Expressed in quadriceps femoris and 151 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8K3R3, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GRIP1 (PubMed:16272139).

Interacts (via GBA motif) with guanine nucleotide-binding protein G(i) alpha subunit GNAI3 (inactive GDP-bound form)l low-affinity interaction (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000027362

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8K3R3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8K3R3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 124PHPROSITE-ProRule annotationAdd BLAST109
Domaini134 – 169EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini170 – 205EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini203 – 237EF-hand 3PROSITE-ProRule annotationAdd BLAST35
Domaini290 – 435PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST146
Domaini538 – 654PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini654 – 781C2PROSITE-ProRule annotationAdd BLAST128

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni26 – 53Substrate bindingBy similarityAdd BLAST28

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi213 – 243GBABy similarityAdd BLAST31
Motifi776 – 779PDZ-binding4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi445 – 456Poly-GluAdd BLAST12

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PDZ-binding motif mediates the interaction with GRIP1.
The C2 domain mediates pre-localization to the membrane prior to Ca2+ import and non-selective Ca2+-mediated targeting to various cellular membranes.By similarity
The PH domain is not a critical determinant of the membrane localization.By similarity
The GBA (G-alpha binding and activating) motif mediates binding to the alpha subunits of guanine nucleotide-binding proteins (G proteins).By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0169, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156180

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002738_0_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8K3R3

KEGG Orthology (KO)

More...
KOi
K05857

Identification of Orthologs from Complete Genome Data

More...
OMAi
ALFEHNR

Database of Orthologous Groups

More...
OrthoDBi
368239at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8K3R3

TreeFam database of animal gene trees

More...
TreeFami
TF313216

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR002048, EF_hand_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR001192, PI-PLC_fam
IPR028387, PLC-delta4
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...
PANTHERi
PTHR10336, PTHR10336, 1 hit
PTHR10336:SF31, PTHR10336:SF31, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00168, C2, 1 hit
PF09279, EF-hand_like, 1 hit
PF00169, PH, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00390, PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00239, C2, 1 hit
SM00054, EFh, 3 hits
SM00233, PH, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004, C2, 1 hit
PS50222, EF_HAND_2, 3 hits
PS50003, PH_DOMAIN, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8K3R3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSQIQDLLA TDQDLLLMQE GTMMRKVRTK SWKKLRYFRL QNDGMTVWHG
60 70 80 90 100
SQPESMPKPT FSISDVERIR KGQDSELLRY LVEEFPLEQG FTVVFHGRRP
110 120 130 140 150
NLDLVANSVE EAQIWMRGLQ LLVDLVASMD HQEQMDQMLN EWFQQADRNQ
160 170 180 190 200
DGRMSFREAQ RLLLLMNVEM DEEYAFSLFQ EADVTQSDDL GSEEFVQFYK
210 220 230 240 250
ALTKRTEIEE IFEDFSSDKQ KLTLLEFVDF LRKEQKEKDH APDLALELID
260 270 280 290 300
RYEPSENGRL LHVLSKDGFL KYLCSKDGNI FNSDCLPIYQ DMTQPLSHYY
310 320 330 340 350
INSSHNTYLV GDQLCGQSSV EGYIRALKRG CRCVEVDTWD GPDGEPVVYH
360 370 380 390 400
GHTLTSRILF KDVLATLAQY AFQSSDYPLI LSLENHCTWE QQRTMAHHLT
410 420 430 440 450
EILGEQLLRN TLEGLLVDSM PSPEQLRGKI LVKGKKLRTI EVDKEEEEEE
460 470 480 490 500
EEEELEKDEG PDLDPASPEL DTQPQPETQG QAAGNKKERK KKVMKCPMSC
510 520 530 540 550
LLICGHVMAQ APSSIPESIL LSKQFLLLSS TTIMCPDLSA LVVYLRTVPF
560 570 580 590 600
CSFTHSKENY HIYDISSFSE SKAKNLIKEA GNEFVQHNAR QLCRVYPSGL
610 620 630 640 650
RTDSSNFNPQ EHWNVGCQMV AMNMQTAGSA MDICDGLFRQ NGGSGYVLKP
660 670 680 690 700
EFLRDTQSSF NPERPISLYK AQILVVQVIS GQQLPKVDKT KETTVVDPLV
710 720 730 740 750
KVELYGVPED TKEQETSHVE NNGINPYWGE TFYFRLQVPE LAMLRFVVKD
760 770 780 790 800
YSRKSRNNFI GQYTLPWTCM KQGYRHVSLL SRDGTSLNPA SIFVYTCMQE

DLDMDEP
Length:807
Mass (Da):92,694
Last modified:October 2, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC109F6255CED45F7
GO
Isoform 2 (identifier: Q8K3R3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     493-524: Missing.

Show »
Length:775
Mass (Da):89,296
Checksum:iEFA6651F8635BBF7
GO
Isoform 3 (identifier: Q8K3R3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     493-524: Missing.
     773-807: GYRHVSLLSRDGTSLNPASIFVYTCMQEDLDMDEP → EMALASIQLP...LKIQSQPKDQ

Show »
Length:798
Mass (Da):92,091
Checksum:i5D5EEC1B9028824D
GO
Isoform 4 (identifier: Q8K3R3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     494-496: MKC → SQD
     497-807: Missing.

Show »
Length:496
Mass (Da):57,480
Checksum:i85050CCD6471FB72
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RGN2D6RGN2_MOUSE
Phosphoinositide phospholipase C
Plcd4
574Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti180Q → R in BAE24292 (PubMed:16141072).Curated1
Sequence conflicti310V → A in AAH66156 (PubMed:15489334).Curated1
Sequence conflicti372F → L in AAH66156 (PubMed:15489334).Curated1
Sequence conflicti445Missing in BAE24292 (PubMed:16141072).Curated1
Sequence conflicti470L → F in AAK61537 (Ref. 1) Curated1
Sequence conflicti594R → C in AAH66156 (PubMed:15489334).Curated1
Sequence conflicti653L → V in AAK61537 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028503493 – 524Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_028504494 – 496MKC → SQD in isoform 4. 1 Publication3
Alternative sequenceiVSP_028505497 – 807Missing in isoform 4. 1 PublicationAdd BLAST311
Alternative sequenceiVSP_028506773 – 807GYRHV…DMDEP → EMALASIQLPSLYTPACRKT WIWMSPEKHREGLEEQSTDA QSFPTYNFLKIQSQPKDQ in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY033991 mRNA Translation: AAK61537.1
AK016945 mRNA Translation: BAB30513.1
AK039149 mRNA Translation: BAC30256.1
AK140231 mRNA Translation: BAE24292.1
BC066156 mRNA Translation: AAH66156.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35616.1 [Q8K3R3-1]
CCDS35617.1 [Q8K3R3-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001074925.1, NM_001081456.1 [Q8K3R3-2]
NP_683739.2, NM_148937.2 [Q8K3R3-1]
XP_006495851.1, XM_006495788.3 [Q8K3R3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000027362; ENSMUSP00000027362; ENSMUSG00000026173 [Q8K3R3-1]
ENSMUST00000067916; ENSMUSP00000064413; ENSMUSG00000026173 [Q8K3R3-2]
ENSMUST00000113747; ENSMUSP00000109376; ENSMUSG00000026173 [Q8K3R3-2]
ENSMUST00000113749; ENSMUSP00000109378; ENSMUSG00000026173 [Q8K3R3-1]
ENSMUST00000113750; ENSMUSP00000109379; ENSMUSG00000026173 [Q8K3R3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
18802

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:18802

UCSC genome browser

More...
UCSCi
uc007bmg.1, mouse [Q8K3R3-2]
uc007bmh.1, mouse [Q8K3R3-1]
uc007bmi.1, mouse [Q8K3R3-4]
uc011wnb.1, mouse [Q8K3R3-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY033991 mRNA Translation: AAK61537.1
AK016945 mRNA Translation: BAB30513.1
AK039149 mRNA Translation: BAC30256.1
AK140231 mRNA Translation: BAE24292.1
BC066156 mRNA Translation: AAH66156.1
CCDSiCCDS35616.1 [Q8K3R3-1]
CCDS35617.1 [Q8K3R3-2]
RefSeqiNP_001074925.1, NM_001081456.1 [Q8K3R3-2]
NP_683739.2, NM_148937.2 [Q8K3R3-1]
XP_006495851.1, XM_006495788.3 [Q8K3R3-1]

3D structure databases

SMRiQ8K3R3
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000027362

PTM databases

iPTMnetiQ8K3R3
PhosphoSitePlusiQ8K3R3

Proteomic databases

jPOSTiQ8K3R3
PaxDbiQ8K3R3
PRIDEiQ8K3R3

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
4087, 101 antibodies

Genome annotation databases

EnsembliENSMUST00000027362; ENSMUSP00000027362; ENSMUSG00000026173 [Q8K3R3-1]
ENSMUST00000067916; ENSMUSP00000064413; ENSMUSG00000026173 [Q8K3R3-2]
ENSMUST00000113747; ENSMUSP00000109376; ENSMUSG00000026173 [Q8K3R3-2]
ENSMUST00000113749; ENSMUSP00000109378; ENSMUSG00000026173 [Q8K3R3-1]
ENSMUST00000113750; ENSMUSP00000109379; ENSMUSG00000026173 [Q8K3R3-3]
GeneIDi18802
KEGGimmu:18802
UCSCiuc007bmg.1, mouse [Q8K3R3-2]
uc007bmh.1, mouse [Q8K3R3-1]
uc007bmi.1, mouse [Q8K3R3-4]
uc011wnb.1, mouse [Q8K3R3-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84812
MGIiMGI:107469, Plcd4

Phylogenomic databases

eggNOGiKOG0169, Eukaryota
GeneTreeiENSGT00940000156180
HOGENOMiCLU_002738_0_2_1
InParanoidiQ8K3R3
KOiK05857
OMAiALFEHNR
OrthoDBi368239at2759
PhylomeDBiQ8K3R3
TreeFamiTF313216

Enzyme and pathway databases

ReactomeiR-MMU-1855204, Synthesis of IP3 and IP4 in the cytosol

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
18802, 1 hit in 19 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Plcd4, mouse

Protein Ontology

More...
PROi
PR:Q8K3R3
RNActiQ8K3R3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000026173, Expressed in quadriceps femoris and 151 other tissues
GenevisibleiQ8K3R3, MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR002048, EF_hand_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR001192, PI-PLC_fam
IPR028387, PLC-delta4
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336, PTHR10336, 1 hit
PTHR10336:SF31, PTHR10336:SF31, 1 hit
PfamiView protein in Pfam
PF00168, C2, 1 hit
PF09279, EF-hand_like, 1 hit
PF00169, PH, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit
PRINTSiPR00390, PHPHLIPASEC
SMARTiView protein in SMART
SM00239, C2, 1 hit
SM00054, EFh, 3 hits
SM00233, PH, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit
SUPFAMiSSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit
PS50222, EF_HAND_2, 3 hits
PS50003, PH_DOMAIN, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCD4_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8K3R3
Secondary accession number(s): Q3USN9
, Q6NZF7, Q8CAB1, Q9CUC1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: August 12, 2020
This is version 147 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again