Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glucocorticoid-induced transcript 1 protein

Gene

Glcci1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Glucocorticoid-induced transcript 1 protein
Alternative name(s):
Glucocorticoid-induced gene 18 protein
Testhymin
Thymocyte/spermatocyte selection protein 1
Gene namesi
Name:Glcci1
Synonyms:Gig18, Tssn1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2179717 Glcci1

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002561291 – 537Glucocorticoid-induced transcript 1 proteinAdd BLAST537

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei69PhosphoserineBy similarity1
Modified residuei96PhosphoserineCombined sources1
Modified residuei98PhosphoserineCombined sources1
Modified residuei99PhosphoserineCombined sources1
Modified residuei101PhosphothreonineCombined sources1
Modified residuei162PhosphoserineBy similarity1
Modified residuei163PhosphoserineBy similarity1
Modified residuei166PhosphothreonineBy similarity1
Modified residuei168PhosphothreonineBy similarity1
Modified residuei214PhosphoserineBy similarity1
Modified residuei248PhosphoserineBy similarity1
Modified residuei256PhosphothreonineBy similarity1
Modified residuei293PhosphoserineCombined sources1
Modified residuei333PhosphothreonineBy similarity1
Modified residuei335PhosphoserineCombined sources1
Modified residuei340PhosphothreonineCombined sources1
Modified residuei384PhosphoserineCombined sources1
Modified residuei388PhosphoserineBy similarity1
Modified residuei396PhosphoserineBy similarity1
Modified residuei402PhosphoserineCombined sources1
Modified residuei470PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ8K3I9
PeptideAtlasiQ8K3I9
PRIDEiQ8K3I9

PTM databases

iPTMnetiQ8K3I9
PhosphoSitePlusiQ8K3I9

Expressioni

Tissue specificityi

Predominantly expressed in thymus and testis, especially in CD4+CD8+ cells and at specific stages of spermatogenesis.1 Publication

Gene expression databases

BgeeiENSMUSG00000029638 Expressed in 37 organ(s), highest expression level in thymus
CleanExiMM_GLCCI1
ExpressionAtlasiQ8K3I9 baseline and differential
GenevisibleiQ8K3I9 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000069444

Structurei

3D structure databases

ProteinModelPortaliQ8K3I9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili217 – 244Sequence analysisAdd BLAST28

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 9Poly-Ser5
Compositional biasi74 – 82Poly-Ala9
Compositional biasi515 – 518Poly-Gln4

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEAU Eukaryota
ENOG4111PY2 LUCA
GeneTreeiENSGT00390000005655
HOGENOMiHOG000252927
HOVERGENiHBG079782
InParanoidiQ8K3I9
PhylomeDBiQ8K3I9

Family and domain databases

InterProiView protein in InterPro
IPR026639 Glcci1
IPR026642 Glcci1/FAM117
PANTHERiPTHR14972 PTHR14972, 1 hit
PTHR14972:SF3 PTHR14972:SF3, 1 hit
PfamiView protein in Pfam
PF15388 FAM117, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8K3I9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTASSSSSQ TPHSAPQRMR RSTAGSPPAA AGSGTGPAGS CAPAAGAGRL
60 70 80 90 100
LQPIRATVPY QLLRGSQHSP TRPAAAATAA AALGSLSGPG GARGPSPSSP
110 120 130 140 150
TPPPAAAPAE QAPRAKGRPR RSPESRRRSS SPERRSPGSP VCRVDRPKSQ
160 170 180 190 200
HIRTSSTIRR TSSLDTITGP YLTGQWPRDP HVHYPSCMRD KATQTPSCWA
210 220 230 240 250
EEGAEKRSHQ RSASWGSADQ LKEIAKLRQQ LQRSKQSSRH SKEKDRQSPL
260 270 280 290 300
HGNHITISHT QAIGSRSVPM PLSNISVPKS SVSRVPCNVE GISPELEKVF
310 320 330 340 350
IKENNGKEEV SKPLDIPDGR RAPLPAHYRS SSTRSIDTQT PSVQERSSSC
360 370 380 390 400
SSHSPCVSPF CPPESQDGSP CSTEDLLYDR DKDSGSSSPL PKYASSPKPN
410 420 430 440 450
NSYMFKREPP EGCERVKVFE EMASRQPISA PLFSCPDKNK VNFIPTGSAF
460 470 480 490 500
CPVKLLGPLL PASDLMLKNS PNSGQSSALA TLTVEQLSSR VSFTSLSDDT
510 520 530
STADSLEPSA QQPSQQQQLL QDLQVEEHVS TQNYVMI
Length:537
Mass (Da):57,479
Last modified:October 1, 2002 - v1
Checksum:iA0B1D63CAC7534EE
GO
Isoform 2 (identifier: Q8K3I9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: Missing.
     108-143: PAEQAPRAKGRPRRSPESRRRSSSPERRSPGSPVCR → MCPSPWPHMCWRHRAPSATFLTTYSHTMSATTCPDS

Note: No experimental confirmation available.
Show »
Length:430
Mass (Da):47,474
Checksum:i2F96772ADCE96D27
GO
Isoform 3 (identifier: Q8K3I9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Note: No experimental confirmation available.
Show »
Length:350
Mass (Da):38,365
Checksum:i5BE45CA21877FF95
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QKK4E9QKK4_MOUSE
Glucocorticoid-induced transcript 1...
Glcci1
538Annotation score:
E0CXI8E0CXI8_MOUSE
Glucocorticoid-induced transcript 1...
Glcci1
94Annotation score:
A0A0R4J1Z9A0A0R4J1Z9_MOUSE
Glucocorticoid-induced transcript 1...
Glcci1
351Annotation score:
A0A0R4J1Y9A0A0R4J1Y9_MOUSE
Glucocorticoid-induced transcript 1...
Glcci1
237Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti223E → EQ in AAH50802 (PubMed:15489334).Curated1
Sequence conflicti223E → EQ in BAC26078 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0213211 – 187Missing in isoform 3. 2 PublicationsAdd BLAST187
Alternative sequenceiVSP_0213221 – 107Missing in isoform 2. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_021323108 – 143PAEQA…SPVCR → MCPSPWPHMCWRHRAPSATF LTTYSHTMSATTCPDS in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF374476 mRNA Translation: AAK54615.1
AY098636 mRNA Translation: AAM33072.1
BC050802 mRNA Translation: AAH50802.1
AK028709 mRNA Translation: BAC26078.1
CCDSiCCDS71725.1 [Q8K3I9-3]
RefSeqiNP_001273657.1, NM_001286728.1
NP_001273658.1, NM_001286729.1 [Q8K3I9-3]
NP_573499.2, NM_133236.3
UniGeneiMm.210787

Genome annotation databases

EnsembliENSMUST00000161217; ENSMUSP00000124167; ENSMUSG00000029638 [Q8K3I9-3]
GeneIDi170772
KEGGimmu:170772
UCSCiuc009axn.3 mouse [Q8K3I9-2]
uc009axu.2 mouse [Q8K3I9-1]
uc009axw.1 mouse [Q8K3I9-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF374476 mRNA Translation: AAK54615.1
AY098636 mRNA Translation: AAM33072.1
BC050802 mRNA Translation: AAH50802.1
AK028709 mRNA Translation: BAC26078.1
CCDSiCCDS71725.1 [Q8K3I9-3]
RefSeqiNP_001273657.1, NM_001286728.1
NP_001273658.1, NM_001286729.1 [Q8K3I9-3]
NP_573499.2, NM_133236.3
UniGeneiMm.210787

3D structure databases

ProteinModelPortaliQ8K3I9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000069444

PTM databases

iPTMnetiQ8K3I9
PhosphoSitePlusiQ8K3I9

Proteomic databases

PaxDbiQ8K3I9
PeptideAtlasiQ8K3I9
PRIDEiQ8K3I9

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000161217; ENSMUSP00000124167; ENSMUSG00000029638 [Q8K3I9-3]
GeneIDi170772
KEGGimmu:170772
UCSCiuc009axn.3 mouse [Q8K3I9-2]
uc009axu.2 mouse [Q8K3I9-1]
uc009axw.1 mouse [Q8K3I9-3]

Organism-specific databases

CTDi113263
MGIiMGI:2179717 Glcci1

Phylogenomic databases

eggNOGiENOG410IEAU Eukaryota
ENOG4111PY2 LUCA
GeneTreeiENSGT00390000005655
HOGENOMiHOG000252927
HOVERGENiHBG079782
InParanoidiQ8K3I9
PhylomeDBiQ8K3I9

Miscellaneous databases

PROiPR:Q8K3I9
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029638 Expressed in 37 organ(s), highest expression level in thymus
CleanExiMM_GLCCI1
ExpressionAtlasiQ8K3I9 baseline and differential
GenevisibleiQ8K3I9 MM

Family and domain databases

InterProiView protein in InterPro
IPR026639 Glcci1
IPR026642 Glcci1/FAM117
PANTHERiPTHR14972 PTHR14972, 1 hit
PTHR14972:SF3 PTHR14972:SF3, 1 hit
PfamiView protein in Pfam
PF15388 FAM117, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGLCI1_MOUSE
AccessioniPrimary (citable) accession number: Q8K3I9
Secondary accession number(s): Q80YT1, Q8CEA5, Q925C1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 1, 2002
Last modified: September 12, 2018
This is version 90 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again