Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 108 (13 Nov 2019)
Sequence version 1 (01 Oct 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Alpha-tubulin N-acetyltransferase 1

Gene

Atat1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin with a slow enzymatic rate, due to a catalytic site that is not optimized for acetyl transfer. Enters the microtubule through each end and diffuses quickly throughout the lumen of microtubules. Acetylates only long/old microtubules because of its slow acetylation rate since it does not have time to act on dynamically unstable microtubules before the enzyme is released. Required for normal sperm flagellar function. Promotes directional cell locomotion and chemotaxis, through AP2A2-dependent acetylation of alpha-tubulin at clathrin-coated pits that are concentrated at the leading edge of migrating cells. May facilitate primary cilium assembly.UniRule annotation5 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei58Crucial for catalytic activityUniRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Transferase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5617833 Cilium Assembly

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-tubulin N-acetyltransferase 1UniRule annotation (EC:2.3.1.108UniRule annotation)
Short name:
Alpha-TATUniRule annotation
Short name:
Alpha-TAT1UniRule annotation
Short name:
TATUniRule annotation
Alternative name(s):
Acetyltransferase mec-17 homologUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Atat1UniRule annotation
Synonyms:Mec17
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1913869 Atat1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Coated pit, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant mice are viable and show no overt phenotype. Drastic loss of tubulin acetylation in all tissues anlyzed, including in early embryos. In dorsal hippocampus, but not in ventral hippocampus, the dentate gyrus is slightly deformed, showing a prominent bulge in the lateral blade of the granular cell layers. In addition, the lateral ventricle appears to be dilated (PubMed:23720746). Homozygous mutant males exhibit decreased fertility (PubMed:23748901). Mature spermatozoa from cauda epididymis often show the presence of a cytoplasmic droplet attached to the annulus of the tail, indicative of impaired maturation. The flagella length is also significantly decreased in spermatozoa, especially in those cells with a cytoplasmic droplet. Spermatozoa display significantly lower motility than control sperm. However, sperm flagella display the characteristic 9 + 2 organization of axoneme microtubules (PubMed:23748901).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi56K → R: Strong reduction in tubulin acetylation, no effect on tubulin-binding; when associated with R-146; R-233 and R-244. 1 Publication1
Mutagenesisi134G → W: Loss of catalytic activity, but function in microtubule stability not affected; when associated with W-136 and P-139. 1 Publication1
Mutagenesisi136G → W: Loss of activity, but function in microtubule stability not affected; when associated with W-134 and P-139. 1 Publication1
Mutagenesisi139L → P: Loss of activity, but function in microtubule stability not affected; when associated with W-134 and W-136. 1 Publication1
Mutagenesisi146K → R: Strong reduction in tubulin acetylation, no effect on tubulin-binding; when associated with R-56; R-233 and R-244. 1 Publication1
Mutagenesisi233K → R: Strong reduction in tubulin acetylation, no effect on tubulin-binding; when associated with R-56; R-146 and R-244. 1 Publication1
Mutagenesisi244K → R: Strong reduction in tubulin acetylation, no effect on tubulin-binding; when associated with R-56; R-146 and R-233. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003480671 – 421Alpha-tubulin N-acetyltransferase 1Add BLAST421

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei56N6-acetyllysine; by autocatalysisUniRule annotation1 Publication1
Modified residuei146N6-acetyllysine; by autocatalysisUniRule annotation1 Publication1
Modified residuei233N6-acetyllysine; by autocatalysisUniRule annotationCombined sources1 Publication1
Modified residuei244N6-acetyllysine; by autocatalysisUniRule annotation1 Publication1
Modified residuei272PhosphoserineBy similarity1
Modified residuei276PhosphoserineBy similarity1
Modified residuei305Asymmetric dimethylarginineCombined sources1
Modified residuei315PhosphoserineCombined sources1
Modified residuei323Omega-N-methylarginineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autoacetylation strongly increases tubulin acetylation.UniRule annotation1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8K341

PeptideAtlas

More...
PeptideAtlasi
Q8K341

PRoteomics IDEntifications database

More...
PRIDEi
Q8K341

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8K341

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8K341

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8K341

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in neuronal tissues. In the brain, expressed in the cortex, cerebellum and hippocampus, including the pyramidal layers in CA1 and CA3, as well as the granular cell layers in the lateral blade (suprapyramidal portion) and the medial blade (infrapyramidal portion) of the dentate gyrus. In testis, mainly expressed in the internal cell layers of seminiferous tubules, where spermatocytes and spermatids are located.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Widely expressed in embryos during development with particularly high expression in the spinal cord at 13.5 dpc.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000024426 Expressed in 213 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8K341 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8K341 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the BBSome complex (By similarity).

Interacts with AP2 alpha-adaptins, including AP2A2, but not with AP1 gamma-adaptin (AP1G1/AP1G2); this interaction is required for efficient alpha-tubulin acetylation, hence clathrin-coated pits are sites of microtubule acetylation.

UniRule annotation1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
215858, 1 interactor

Database of interacting proteins

More...
DIPi
DIP-60604N

Protein interaction database and analysis system

More...
IntActi
Q8K341, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000056383

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8K341

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 190N-acetyltransferaseUniRule annotationAdd BLAST190

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni124 – 137Acetyl-CoA bindingUniRule annotationAdd BLAST14
Regioni160 – 169Acetyl-CoA bindingUniRule annotation10
Regioni308 – 387Required for AP2A2-bindingAdd BLAST80

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the acetyltransferase ATAT1 family.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4601 Eukaryota
ENOG4111Q8H LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008276

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8K341

KEGG Orthology (KO)

More...
KOi
K19573

Identification of Orthologs from Complete Genome Data

More...
OMAi
HESRQRC

Database of Orthologous Groups

More...
OrthoDBi
1312675at2759

TreeFam database of animal gene trees

More...
TreeFami
TF315643

Family and domain databases

HAMAP database of protein families

More...
HAMAPi
MF_03130 mec17, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038746 Atat
IPR007965 GNAT_ATAT

The PANTHER Classification System

More...
PANTHERi
PTHR12327 PTHR12327, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05301 Acetyltransf_16, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51730 GNAT_ATAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q8K341-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEFPFDVDAL FPERITVLDQ HLRPPARRPG TTTPARVDLQ QQIMTIVDEL
60 70 80 90 100
GKASAKAQHL PAPITSALRM QSNRHVIYIL KDTSARPAGK GAIIGFLKVG
110 120 130 140 150
YKKLFVLDDR EAHNEVEPLC ILDFYIHESV QRHGHGRELF QHMLQKERVE
160 170 180 190 200
PHQLAIDRPS PKLLKFLNKH YNLETTVPQV NNFVIFEGFF AHQHRPPTSS
210 220 230 240 250
LRATRHSRAA VADPIPAAPA RKLPPKRAEG DIKPYSSSDR EFLKVAVEPP
260 270 280 290 300
WPLNRAPRRA TPPAHPPPRS SSLGNSPDRG PLRPFVPEQE LLRSLRLCPP
310 320 330 340 350
HPTARLLLAT DPGGSPAQRR RTRGTPWGLV AQSCHYSRHG GFNTSFLGTG
360 370 380 390 400
NQERKQGEQE AEDRSASEDR VLLLDGSGEE PTQTGAPRAQ APPPQSWTVG
410 420
GDIMNARVIR NLQERRSTRP W
Length:421
Mass (Da):47,164
Last modified:October 1, 2002 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE47F1060F183D19C
GO
Isoform 21 Publication (identifier: Q8K341-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-218: RPPTSSLRATRHSRAAVADPIPAA → P

Show »
Length:398
Mass (Da):44,780
Checksum:i274CC3D32CA11CB1
GO
Isoform 31 Publication (identifier: Q8K341-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     324-353: GTPWGLVAQSCHYSRHGGFNTSFLGTGNQE → SHTHTTTVSLDAWYFHRQPRTEAGGTGSGG
     354-421: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:353
Mass (Da):39,603
Checksum:iC42201C82267F320
GO
Isoform 41 Publication (identifier: Q8K341-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     323-333: RGTPWGLVAQS → SSLPRSDESRY
     334-421: Missing.

Show »
Length:333
Mass (Da):37,528
Checksum:i7D54796E19DD98F3
GO
Isoform 51 Publication (identifier: Q8K341-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-218: RPPTSSLRATRHSRAAVADPIPAA → P
     323-333: RGTPWGLVAQS → SSLPRSDESRY
     334-421: Missing.

Show »
Length:310
Mass (Da):35,144
Checksum:iF70634A8F614833E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8JJ72B8JJ72_MOUSE
Alpha-tubulin N-acetyltransferase 1
Atat1
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7BUT2F7BUT2_MOUSE
Alpha-tubulin N-acetyltransferase 1
Atat1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RPX5F6RPX5_MOUSE
Alpha-tubulin N-acetyltransferase 1
Atat1
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7CID0F7CID0_MOUSE
Alpha-tubulin N-acetyltransferase 1
Atat1
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti92A → V in AAH30669 (PubMed:15489334).Curated1
Sequence conflicti102K → E in BAC28808 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_052905195 – 218RPPTS…PIPAA → P in isoform 2 and isoform 5. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_052906323 – 333RGTPWGLVAQS → SSLPRSDESRY in isoform 4 and isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_052908324 – 353GTPWG…TGNQE → SHTHTTTVSLDAWYFHRQPR TEAGGTGSGG in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_052907334 – 421Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_052909354 – 421Missing in isoform 3. 1 PublicationAdd BLAST68

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK028297 mRNA Translation: BAC25866.1
AK034725 mRNA Translation: BAC28808.1
AK133694 mRNA Translation: BAE21786.1
CR974451 Genomic DNA No translation available.
BC028847 mRNA Translation: AAH28847.1
BC030669 mRNA Translation: AAH30669.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28711.1 [Q8K341-5]
CCDS50096.1 [Q8K341-1]
CCDS50097.1 [Q8K341-4]
CCDS84305.1 [Q8K341-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001136216.1, NM_001142744.1 [Q8K341-1]
NP_001136217.1, NM_001142745.1 [Q8K341-4]
NP_001334307.1, NM_001347378.1 [Q8K341-2]
NP_082752.3, NM_028476.4 [Q8K341-5]
XP_017173163.1, XM_017317674.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000056034; ENSMUSP00000053853; ENSMUSG00000024426 [Q8K341-5]
ENSMUST00000061052; ENSMUSP00000056383; ENSMUSG00000024426 [Q8K341-1]
ENSMUST00000077494; ENSMUSP00000076703; ENSMUSG00000024426 [Q8K341-2]
ENSMUST00000141662; ENSMUSP00000115004; ENSMUSG00000024426 [Q8K341-4]
ENSMUST00000149277; ENSMUSP00000122715; ENSMUSG00000024426 [Q8K341-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
73242

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:73242

UCSC genome browser

More...
UCSCi
uc008cja.3 mouse [Q8K341-1]
uc008cjb.3 mouse [Q8K341-3]
uc008cjc.3 mouse [Q8K341-2]
uc008cjd.3 mouse [Q8K341-5]
uc008cje.3 mouse [Q8K341-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028297 mRNA Translation: BAC25866.1
AK034725 mRNA Translation: BAC28808.1
AK133694 mRNA Translation: BAE21786.1
CR974451 Genomic DNA No translation available.
BC028847 mRNA Translation: AAH28847.1
BC030669 mRNA Translation: AAH30669.1
CCDSiCCDS28711.1 [Q8K341-5]
CCDS50096.1 [Q8K341-1]
CCDS50097.1 [Q8K341-4]
CCDS84305.1 [Q8K341-2]
RefSeqiNP_001136216.1, NM_001142744.1 [Q8K341-1]
NP_001136217.1, NM_001142745.1 [Q8K341-4]
NP_001334307.1, NM_001347378.1 [Q8K341-2]
NP_082752.3, NM_028476.4 [Q8K341-5]
XP_017173163.1, XM_017317674.1

3D structure databases

SMRiQ8K341
ModBaseiSearch...

Protein-protein interaction databases

BioGridi215858, 1 interactor
DIPiDIP-60604N
IntActiQ8K341, 1 interactor
STRINGi10090.ENSMUSP00000056383

PTM databases

iPTMnetiQ8K341
PhosphoSitePlusiQ8K341
SwissPalmiQ8K341

Proteomic databases

PaxDbiQ8K341
PeptideAtlasiQ8K341
PRIDEiQ8K341

Genome annotation databases

EnsembliENSMUST00000056034; ENSMUSP00000053853; ENSMUSG00000024426 [Q8K341-5]
ENSMUST00000061052; ENSMUSP00000056383; ENSMUSG00000024426 [Q8K341-1]
ENSMUST00000077494; ENSMUSP00000076703; ENSMUSG00000024426 [Q8K341-2]
ENSMUST00000141662; ENSMUSP00000115004; ENSMUSG00000024426 [Q8K341-4]
ENSMUST00000149277; ENSMUSP00000122715; ENSMUSG00000024426 [Q8K341-3]
GeneIDi73242
KEGGimmu:73242
UCSCiuc008cja.3 mouse [Q8K341-1]
uc008cjb.3 mouse [Q8K341-3]
uc008cjc.3 mouse [Q8K341-2]
uc008cjd.3 mouse [Q8K341-5]
uc008cje.3 mouse [Q8K341-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79969
MGIiMGI:1913869 Atat1

Phylogenomic databases

eggNOGiKOG4601 Eukaryota
ENOG4111Q8H LUCA
GeneTreeiENSGT00390000008276
InParanoidiQ8K341
KOiK19573
OMAiHESRQRC
OrthoDBi1312675at2759
TreeFamiTF315643

Enzyme and pathway databases

ReactomeiR-MMU-5617833 Cilium Assembly

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Atat1 mouse

Protein Ontology

More...
PROi
PR:Q8K341

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000024426 Expressed in 213 organ(s), highest expression level in forebrain
ExpressionAtlasiQ8K341 baseline and differential
GenevisibleiQ8K341 MM

Family and domain databases

HAMAPiMF_03130 mec17, 1 hit
InterProiView protein in InterPro
IPR038746 Atat
IPR007965 GNAT_ATAT
PANTHERiPTHR12327 PTHR12327, 1 hit
PfamiView protein in Pfam
PF05301 Acetyltransf_16, 1 hit
PROSITEiView protein in PROSITE
PS51730 GNAT_ATAT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATAT_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8K341
Secondary accession number(s): B8JJ75
, B8JJ77, Q3UZR9, Q8BM67, Q8C1D1, Q8K2M7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: October 1, 2002
Last modified: November 13, 2019
This is version 108 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again