Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (16 Oct 2019)
Sequence version 3 (24 Jun 2015)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Adhesion G protein-coupled receptor L2

Gene

Adgrl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-independent receptor of low affinity for alpha-latrotoxin, an excitatory neurotoxin present in black widow spider venom which triggers massive exocytosis from neurons and neuroendocrine cells. Receptor probably implicated in the regulation of exocytosis.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPS protease database

More...
MEROPSi
P02.009

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adhesion G protein-coupled receptor L2
Alternative name(s):
Calcium-independent alpha-latrotoxin receptor 2
Short name:
CIRL-2
Latrophilin-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Adgrl2
Synonyms:Kiaa0786, Lphn2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2139714 Adgrl2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini26 – 855ExtracellularCuratedAdd BLAST830
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei856 – 876Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini877 – 884CytoplasmicCurated8
Transmembranei885 – 905Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini906 – 911ExtracellularCurated6
Transmembranei912 – 932Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini933 – 955CytoplasmicCuratedAdd BLAST23
Transmembranei956 – 976Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini977 – 994ExtracellularCuratedAdd BLAST18
Transmembranei995 – 1015Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini1016 – 1064CytoplasmicCuratedAdd BLAST49
Transmembranei1065 – 1085Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini1086 – 1090ExtracellularCurated5
Transmembranei1091 – 1111Helical; Name=7Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000007034326 – 1487Adhesion G protein-coupled receptor L2Add BLAST1462

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi99N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi524N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi735N-linked (GlcNAc...) asparagine2 Publications1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1402PhosphoserineCombined sources1
Modified residuei1437PhosphoserineCombined sources1
Modified residuei1458PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei828 – 829CleavageBy similarity2

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8JZZ7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8JZZ7

PeptideAtlas

More...
PeptideAtlasi
Q8JZZ7

PRoteomics IDEntifications database

More...
PRIDEi
Q8JZZ7

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2418 [Q8JZZ7-2]

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8JZZ7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8JZZ7

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8JZZ7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Decrease in mRNA levels during postnatal development.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028184 Expressed in 239 organ(s), highest expression level in metanephros

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8JZZ7 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a heterodimer, consisting of a large extracellular region non-covalently linked to a seven-transmembrane moiety.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000101734

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8JZZ7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini41 – 130SUEL-type lectinPROSITE-ProRule annotationAdd BLAST90
Domaini139 – 398Olfactomedin-likePROSITE-ProRule annotationAdd BLAST260
Domaini789 – 840GPSPROSITE-ProRule annotationAdd BLAST52

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3545 Eukaryota
KOG4193 Eukaryota
KOG4729 Eukaryota
ENOG410XSD2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156348

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049065

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8JZZ7

Identification of Orthologs from Complete Genome Data

More...
OMAi
MHSDTPG

TreeFam database of animal gene trees

More...
TreeFami
TF351999

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.1240.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032471 GAIN_dom_N
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR003924 GPCR_2_latrophilin
IPR003334 GPCR_2_latrophilin_rcpt_C
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
IPR031240 Latrophilin-2
IPR000922 Lectin_gal-bd_dom
IPR003112 Olfac-like_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12011:SF61 PTHR12011:SF61, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00002 7tm_2, 1 hit
PF16489 GAIN, 1 hit
PF02140 Gal_Lectin, 1 hit
PF01825 GPS, 1 hit
PF02793 HRM, 1 hit
PF02354 Latrophilin, 1 hit
PF02191 OLF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00249 GPCRSECRETIN
PR01444 LATROPHILIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00303 GPS, 1 hit
SM00008 HormR, 1 hit
SM00284 OLF, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit
PS51132 OLF, 1 hit
PS50228 SUEL_LECTIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8JZZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSSGCRMRS LWFIIIISFS PSTEGFSRAA LPFGLVRREL SCEGYSIDLR
60 70 80 90 100
CPGSDVIMIE SANYGRTDDK ICDADPFQME NTDCYLPDAF KIMTQRCNNR
110 120 130 140 150
TQCIVVTGSD VFPDPCPGTY KYLEVQYECV PYSKMLVFVC PGTLKAIVDS
160 170 180 190 200
PCIYEAEQKS GAWCKDPLQA ADKIYFMPWT PYRTDTLIEY ASLEDFQNSR
210 220 230 240 250
QTTTYKLPNR VDGTGFVVYD GAVFFNKERT RNIVKFDLRT RIKSGEAIIN
260 270 280 290 300
YANYHDTSPY RWGGKTDIDL AVDENGLWVI YATEQNNGMI VISQLNPYTL
310 320 330 340 350
RFEATWETAY DKRAASNAFM ICGVLYVVRS VYQDNESEAG KNTIDYIYNT
360 370 380 390 400
RLSRGEYVDV PFPNQYQYIA AVDYNPRDNQ LYVWNNNFIL RYSLEFGPPD
410 420 430 440 450
PAQVPTTAVT ITSSAELFKT TISTTSSASQ RGPVSSTAAG PQDGSRGTKP
460 470 480 490 500
PPAVSTTKIP PVTNIFPLPE RFCEALDWKG IKWPQTQRGM MVERPCPKGT
510 520 530 540 550
RGTASYLCMA STGTWNPKGP DLSNCTSHWV NQLAQKIRSG ENAASLANEL
560 570 580 590 600
AKHTKGHVFA GDVSSSVRLM EQLVDILDAQ LQELKPSEKD SAGRSYNKLQ
610 620 630 640 650
KREKTCRAYL KAIVDTVDNL LRAEALESWK HMNSSEQAHT ATMLLDTLEE
660 670 680 690 700
GAFVLADNLL EPTRVSMPTE NIVLEVAVLS TEGQVQDFKF PLGLKGLGSS
710 720 730 740 750
IQLSANTVKQ NSRNGLAKLV FIIYRSLGQF LSTENATIKL GADLMGRNST
760 770 780 790 800
IAVNSPVISV SINKESSRVY LTDPVLFTLP HIDPDNYFNA NCSFWNYSER
810 820 830 840 850
TMMGYWSTQG CKLVDTNKTR TTCACSHLTN FAILMAHREI AYKDGVHHLL
860 870 880 890 900
LTVITWVGIV VSLVCLAICI FTFCFFRGLQ SDRNTIHKNL CINLFIAEFI
910 920 930 940 950
FLIGIDKTKY TIACPVFAGL LHFFFLAAFS WMCLEGVQLY LMLVEVFESE
960 970 980 990 1000
YSRKKYYYVA GYLFPATVVG VSAAIDYKSY GTVQACWLHV DNYFIWSFIG
1010 1020 1030 1040 1050
PVTFIILLNI IFLVITLCKM VKHSNTLKPD SSRLENINNY RVCDGYYNTD
1060 1070 1080 1090 1100
LPGYEDNKPF IKSWVLGAFA LLCLLGLTWS FGLLFVNEET VVMAYLFTAF
1110 1120 1130 1140 1150
NAFQGLFIFI FHCALQKKVR KEYGKCFRHW YCCGGLPTES PHSSVKASTT
1160 1170 1180 1190 1200
RTSARYSSGT QSRIRRMWND TVRKQSESSF ISGDINSTST LNQGMTGNYL
1210 1220 1230 1240 1250
LTNPLLRPHG TNNPYNTLLA ETVVCNAPSA PAFNSPGHSL NNARDTSAMD
1260 1270 1280 1290 1300
TLPLNGNFNN SYSLRKADYH DGVQVVDCGL SLNDTAFEKM IISELVHNNL
1310 1320 1330 1340 1350
RGGNKTHNLE LKLPVKPVIG GSSSEDDAIV ADASSLMHGD NPGLEFRHKE
1360 1370 1380 1390 1400
LEAPLIPQRT HSLLYQPQKK VKPEATDSYV SQLTAEADDH LQSPNRDSLY
1410 1420 1430 1440 1450
TSMPNLRDSP YPESSPDMAE DLSPSRRSEN EDIYYKSMPN LGAGRHLHMC
1460 1470 1480
YQISRGNSDG YIIPINKEGC IPEGDVREGQ MQLVTSL
Length:1,487
Mass (Da):166,577
Last modified:June 24, 2015 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA56F7A5409E801F8
GO
Isoform 2 (identifier: Q8JZZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1062-1062: K → NNYRVCDGYYNTDLPG
     1194-1194: G → GMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPATYRETR

Show »
Length:1,551
Mass (Da):173,640
Checksum:iE74F891832FBABBC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JGM8A0A0G2JGM8_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,487Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JDE3A0A0G2JDE3_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,403Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JDF4A0A0G2JDF4_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,452Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JDK6A0A0G2JDK6_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,478Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JFF5A0A0G2JFF5_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,467Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JG66A0A0G2JG66_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,435Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JEQ8A0A0G2JEQ8_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,123Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JFV3A0A0G2JFV3_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,341Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JH16A0A0G2JH16_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
1,177Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JE37A0A0G2JE37_MOUSE
Adhesion G protein-coupled receptor...
Adgrl2
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH34660 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0101101062K → NNYRVCDGYYNTDLPG in isoform 2. 1 Publication1
Alternative sequenceiVSP_0101111194G → GMTGNYLLTNPLLRPHGTNN PYNTLLAETVVCNAPSAPAF NSPATYRETR in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC113315 Genomic DNA No translation available.
AC114679 Genomic DNA No translation available.
AC138591 Genomic DNA No translation available.
AK129215 mRNA Translation: BAC98025.1
AK034430 mRNA Translation: BAC28707.1
BC034660 mRNA Translation: AAH34660.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS80059.1 [Q8JZZ7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000106128; ENSMUSP00000101734; ENSMUSG00000028184 [Q8JZZ7-1]

UCSC genome browser

More...
UCSCi
uc008rsa.1 mouse [Q8JZZ7-1]
uc008rsb.1 mouse

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC113315 Genomic DNA No translation available.
AC114679 Genomic DNA No translation available.
AC138591 Genomic DNA No translation available.
AK129215 mRNA Translation: BAC98025.1
AK034430 mRNA Translation: BAC28707.1
BC034660 mRNA Translation: AAH34660.1 Different initiation.
CCDSiCCDS80059.1 [Q8JZZ7-1]

3D structure databases

SMRiQ8JZZ7
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000101734

Protein family/group databases

MEROPSiP02.009

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

GlyConnecti2418 [Q8JZZ7-2]
iPTMnetiQ8JZZ7
PhosphoSitePlusiQ8JZZ7
SwissPalmiQ8JZZ7

Proteomic databases

jPOSTiQ8JZZ7
PaxDbiQ8JZZ7
PeptideAtlasiQ8JZZ7
PRIDEiQ8JZZ7

Genome annotation databases

EnsembliENSMUST00000106128; ENSMUSP00000101734; ENSMUSG00000028184 [Q8JZZ7-1]
UCSCiuc008rsa.1 mouse [Q8JZZ7-1]
uc008rsb.1 mouse

Organism-specific databases

MGIiMGI:2139714 Adgrl2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3545 Eukaryota
KOG4193 Eukaryota
KOG4729 Eukaryota
ENOG410XSD2 LUCA
GeneTreeiENSGT00940000156348
HOGENOMiHOG000049065
InParanoidiQ8JZZ7
OMAiMHSDTPG
TreeFamiTF351999

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Adgrl2 mouse

Protein Ontology

More...
PROi
PR:Q8JZZ7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028184 Expressed in 239 organ(s), highest expression level in metanephros
ExpressionAtlasiQ8JZZ7 baseline and differential

Family and domain databases

Gene3Di4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR032471 GAIN_dom_N
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR003924 GPCR_2_latrophilin
IPR003334 GPCR_2_latrophilin_rcpt_C
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
IPR031240 Latrophilin-2
IPR000922 Lectin_gal-bd_dom
IPR003112 Olfac-like_dom
PANTHERiPTHR12011:SF61 PTHR12011:SF61, 1 hit
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF16489 GAIN, 1 hit
PF02140 Gal_Lectin, 1 hit
PF01825 GPS, 1 hit
PF02793 HRM, 1 hit
PF02354 Latrophilin, 1 hit
PF02191 OLF, 1 hit
PRINTSiPR00249 GPCRSECRETIN
PR01444 LATROPHILIN
SMARTiView protein in SMART
SM00303 GPS, 1 hit
SM00008 HormR, 1 hit
SM00284 OLF, 1 hit
PROSITEiView protein in PROSITE
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit
PS51132 OLF, 1 hit
PS50228 SUEL_LECTIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAGRL2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8JZZ7
Secondary accession number(s): E9Q6C7, Q8BM90
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: June 24, 2015
Last modified: October 16, 2019
This is version 130 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again