Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q8IZU0 (FAM9B_HUMAN)

Entry version 135 (23 Feb 2022)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Protein FAM9B

Gene

FAM9B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8IZU0

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q8IZU0

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q8IZU0, Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM9B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM9B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:18404, FAM9B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300478, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8IZU0

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000177138

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000177138

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27993

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8IZU0, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FAM9B

Domain mapping of disease mutations (DMDM)

More...DMDMi		29336758

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001190331 – 186Protein FAM9BAdd BLAST186

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8IZU0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8IZU0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8IZU0

PeptideAtlas

More...PeptideAtlasi		Q8IZU0

PRoteomics IDEntifications database

More...PRIDEi		Q8IZU0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed exclusively in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000177138, Expressed in testis and 58 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8IZU0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8IZU0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000177138, Tissue enhanced (liver, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q8IZU0
With#Exp.IntAct
ABT1 [Q9ULW3]3EBI-10175124,EBI-2602396
ANKRD36B [Q8N2N9]3EBI-10175124,EBI-2876112
AP1M1 [Q9BXS5]3EBI-10175124,EBI-541426
ASB6 [Q9NWX5]3EBI-10175124,EBI-6425205
ATF7 [P17544]3EBI-10175124,EBI-765623
AURKAIP1 [Q9NWT8]3EBI-10175124,EBI-448665
BAG6 [P46379]3EBI-10175124,EBI-347552
BARD1 [Q99728]3EBI-10175124,EBI-473181
BCL2A1 [Q16548]3EBI-10175124,EBI-1003550
BET1 [Q53XK0]3EBI-10175124,EBI-10242927
BLOC1S2 [Q6QNY1]3EBI-10175124,EBI-465872
BRME1 [Q0VDD7]3EBI-10175124,EBI-741210
BYSL [Q13895]5EBI-10175124,EBI-358049
C16orf72 [Q14CZ0]5EBI-10175124,EBI-10234807
C8orf33 [Q9H7E9]3EBI-10175124,EBI-715389
CADPS - isoform 4 [Q9ULU8-4]3EBI-10175124,EBI-10180690
CCDC106 [Q9BWC9]8EBI-10175124,EBI-711501
CCDC116 [Q8IYX3]3EBI-10175124,EBI-744311
CCDC198 [Q9NVL8]3EBI-10175124,EBI-10238351
CCDC70 [Q6NSX1]3EBI-10175124,EBI-6873045
CDC23 [Q9UJX2]3EBI-10175124,EBI-396137
CDC37 [Q16543]3EBI-10175124,EBI-295634
CDC42EP4 [Q9H3Q1]5EBI-10175124,EBI-744665
CDCA7L [Q96GN5]3EBI-10175124,EBI-5278764
CENPL [Q8N0S6]3EBI-10175124,EBI-8467109
CEP57L1 - isoform 2 [Q8IYX8-2]3EBI-10175124,EBI-10181988
CEP95 [Q96GE4]4EBI-10175124,EBI-372775
CHRAC1 [Q9NRG0]7EBI-10175124,EBI-2795492
CLCN1 [P35523]3EBI-10175124,EBI-10206780
COL20A1 - isoform 2 [Q9P218-2]3EBI-10175124,EBI-10318410
CSDE1 [O75534]3EBI-10175124,EBI-719186
CWF19L2 [Q2TBE0]3EBI-10175124,EBI-5453285
DAPK2 [Q9UIK4]4EBI-10175124,EBI-77154
DAXX [Q9UER7]4EBI-10175124,EBI-77321
DENND2D [Q9H6A0]3EBI-10175124,EBI-10307465
DGUOK [A0A0S2Z3T7]4EBI-10175124,EBI-16436767
DNAJC15 [Q9Y5T4]3EBI-10175124,EBI-10329228
DNAJC4 [Q96FY5]3EBI-10175124,EBI-10286235
EBNA1BP2 [Q6IB29]3EBI-10175124,EBI-10249955
EBNA1BP2 [Q99848]5EBI-10175124,EBI-1048111
ECH1 [Q13011]3EBI-10175124,EBI-711968
EIF3G [O75821]3EBI-10175124,EBI-366632
ELOA [Q14241]3EBI-10175124,EBI-742350
FAM161A [Q3B820]3EBI-10175124,EBI-719941
FAM9A [Q8IZU1]5EBI-10175124,EBI-8468186
FASTKD3 [Q14CZ7]4EBI-10175124,EBI-10234819
FCHSD2 [O94868]4EBI-10175124,EBI-1215612
FERD3L [Q96RJ6]4EBI-10175124,EBI-10183007
FNDC11 [Q9BVV2]3EBI-10175124,EBI-744935
GFOD1 [Q9NXC2]4EBI-10175124,EBI-8799578
GOPC - isoform 2 [Q9HD26-2]3EBI-10175124,EBI-11102276
GRAMD4 [Q6IC98]3EBI-10175124,EBI-10962409
GSTK1 [Q9Y2Q3]4EBI-10175124,EBI-1053767
IBSP [P21815]3EBI-10175124,EBI-18400392
ISCU [Q9H1K1]3EBI-10175124,EBI-1047335
JAZF1 [Q86VZ6]3EBI-10175124,EBI-11023753
LBX1 [P52954]3EBI-10175124,EBI-20141748
LIN7A [O14910]3EBI-10175124,EBI-2513988
LNX1 [Q8TBB1]3EBI-10175124,EBI-739832
LYRM2 [Q9NU23]4EBI-10175124,EBI-10313813
MAB21L3 [Q8N8X9]3EBI-10175124,EBI-10268010
MFAP1 [P55081]3EBI-10175124,EBI-1048159
MGC24125 [Q8NEQ2]3EBI-10175124,EBI-10270788
MOB1A [Q9H8S9]3EBI-10175124,EBI-748229
MORF4L1 [Q9UBU8]3EBI-10175124,EBI-399246
MORF4L2 [Q15014]3EBI-10175124,EBI-399257
MRPL10 [Q7Z7H8]3EBI-10175124,EBI-723524
MRPL28 [Q13084]3EBI-10175124,EBI-723426
MRPL9 [Q9BYD2]3EBI-10175124,EBI-726059
MRRF [Q96E11]3EBI-10175124,EBI-2855755
MYG1 [Q9HB07]4EBI-10175124,EBI-709754
NDUFB10 [O96000]6EBI-10175124,EBI-1246371
NEBL [O76041]3EBI-10175124,EBI-2880203
NOL4 - isoform 2 [O94818-2]3EBI-10175124,EBI-10190763
NOTO [A8MTQ0]3EBI-10175124,EBI-17490746
PAGE1 [O75459]3EBI-10175124,EBI-2559100
PAGE3 [Q5JUK9]3EBI-10175124,EBI-10244544
PHYH [O14832]7EBI-10175124,EBI-721853
PIN4 [Q9Y237]4EBI-10175124,EBI-714599
POLL - isoform 2 [Q9UGP5-2]3EBI-10175124,EBI-10320765
PPP1R18 [Q6NYC8]3EBI-10175124,EBI-2557469
PRPF3 [O43395]9EBI-10175124,EBI-744322
PSMD14 [O00487]3EBI-10175124,EBI-722193
PTRH1 [Q86Y79]3EBI-10175124,EBI-2602515
RAB17 [Q9H0T7]3EBI-10175124,EBI-721615
RAD51B [O15315]3EBI-10175124,EBI-2824089
RBM17 [Q96I25]3EBI-10175124,EBI-740272
RBM23 [Q86U06]3EBI-10175124,EBI-780319
RMND1 [Q9NWS8]3EBI-10175124,EBI-4401316
RNF8 [O76064]3EBI-10175124,EBI-373337
RPL9 [P32969]3EBI-10175124,EBI-358122
RSL24D1 [Q9UHA3]3EBI-10175124,EBI-749321
RUBCN [Q92622]3EBI-10175124,EBI-2952709
RUSC1 [Q9BVN2]5EBI-10175124,EBI-6257312
SDCBP [O00560]6EBI-10175124,EBI-727004
SDCBP2 [Q9H190]3EBI-10175124,EBI-742426
SERPINE2 [P07093]3EBI-10175124,EBI-10195168
SFN [P31947]3EBI-10175124,EBI-476295
SLC16A3 [O15427]3EBI-10175124,EBI-7600166
SLPI [P03973]6EBI-10175124,EBI-355293
SMARCB1 - isoform B [Q12824-2]3EBI-10175124,EBI-358436
SMN2 [Q16637]8EBI-10175124,EBI-395421
SNAP29 [O95721]3EBI-10175124,EBI-490676
SNAP47 [Q5SQN1]3EBI-10175124,EBI-10244848
SNX20 [Q7Z614]4EBI-10175124,EBI-744896
SRRM4 [A7MD48]3EBI-10175124,EBI-3867173
STK3 [Q13188]3EBI-10175124,EBI-992580
SUCLA2 [E5KS60]3EBI-10175124,EBI-10176959
SURF6 [O75683]3EBI-10175124,EBI-2691252
SYT17 [Q9BSW7]4EBI-10175124,EBI-745392
TBC1D25 [Q3MII6]3EBI-10175124,EBI-11899977
TBRG4 [Q969Z0]3EBI-10175124,EBI-702328
TCEA2 [Q15560]3EBI-10175124,EBI-710310
TCEANC [Q8N8B7]3EBI-10175124,EBI-954696
TGFBI [Q15582]3EBI-10175124,EBI-10236573
TOM1L2 - isoform 2 [Q6ZVM7-2]5EBI-10175124,EBI-12147805
TRMT61B [Q9BVS5]4EBI-10175124,EBI-3197877
TSG101 [Q99816]3EBI-10175124,EBI-346882
TUFM [A0A384ME17]3EBI-10175124,EBI-12261790
TUFM [P49411]4EBI-10175124,EBI-359097
TXN2 [Q99757]3EBI-10175124,EBI-2932492
UBE2E2 [Q96LR5]3EBI-10175124,EBI-2129763
URB1-AS1 [Q96HZ7]3EBI-10175124,EBI-10288943
XRCC4 [Q13426]7EBI-10175124,EBI-717592
YARS2 [Q9Y2Z4]3EBI-10175124,EBI-1049286
ZCCHC10 [Q8TBK6]3EBI-10175124,EBI-597063
ZGPAT [Q8N5A5]3EBI-10175124,EBI-3439227
ZGPAT - isoform 2 [Q8N5A5-2]3EBI-10175124,EBI-10183064
ZNF41 [P51814]3EBI-10175124,EBI-2681830
ZNF41 - isoform 6 [P51814-6]6EBI-10175124,EBI-12700258
ZNF410 [Q86VK4]3EBI-10175124,EBI-720304
ZNF567 [Q8N184]3EBI-10175124,EBI-749400
ZNF614 [Q8N883]3EBI-10175124,EBI-9675993
ZNF777 [Q9ULD5]3EBI-10175124,EBI-11975599
A0A1U9X8X83EBI-10175124,EBI-17234977
Q9H6143EBI-10175124,EBI-10249899

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		128131, 167 interactors

Protein interaction database and analysis system

More...IntActi		Q8IZU0, 138 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000318716

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8IZU0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8IZU0

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 93DisorderedSequence analysisAdd BLAST93

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi8 – 80Basic and acidic residuesSequence analysisAdd BLAST73

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM9 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502TD36, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000000062

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_083208_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8IZU0

Identification of Orthologs from Complete Genome Data

More...OMAi		RMKMDKA

Database of Orthologous Groups

More...OrthoDBi		1187915at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8IZU0

TreeFam database of animal gene trees

More...TreeFami		TF328876

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006888, XLR/SYCP3/FAM9_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04803, Cor1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8IZU0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAWGKKHAG KDPVRDECEE RNRFTETREE DVTDEHGERE PFAETDEHTG 
        60         70         80         90        100
ANTKKPEDTA EDLTAKRKRM KMDKTCSKTK NKSKHALRKK QLKRQKRDYI 
       110        120        130        140        150
HSLKLLNVLE EYITDEQKEE EEEEGEEEEL IRIFQEQQKK WQQYRSVRRE 
       160        170        180 
RLKEMKLLRD QFVKALEDFE DLCDRVFSDE DSELDN
Length:186
Mass (Da):22,438
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i234509A205433927
GO
Isoform 2 (identifier: Q8IZU0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGFLSFLSVSLRSPGSGIASSFPGQPATDPVGRRAAKAQLEAQFM
     61-93: EDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLK → VGANNFKNYPVHIGVSSEQHILLDCSLS

Show »
Length:226
Mass (Da):26,138
Checksum:iC4695621D44547BE
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0550871M → MPGFLSFLSVSLRSPGSGIA SSFPGQPATDPVGRRAAKAQ LEAQFM in isoform 2. 1 Publication1
Alternative sequenceiVSP_05508861 – 93EDLTA…KKQLK → VGANNFKNYPVHIGVSSEQH ILLDCSLS in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF494344 mRNA Translation: AAN07163.1
AK097501 mRNA Translation: BAC05078.1
AC074281 Genomic DNA No translation available.
AC119567 Genomic DNA No translation available.
AC119618 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98763.1
BC120955 mRNA Translation: AAI20956.1
BC120956 mRNA Translation: AAI20957.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14132.1 [Q8IZU0-1]

NCBI Reference Sequences

More...RefSeqi		NP_995321.1, NM_205849.3 [Q8IZU0-1]
XP_011543766.1, XM_011545464.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000327220; ENSP00000318716; ENSG00000177138
ENST00000362066; ENSP00000354770; ENSG00000177138 [Q8IZU0-2]
ENST00000428477; ENSP00000412606; ENSG00000177138
ENST00000472522; ENSP00000431456; ENSG00000177138
ENST00000651278; ENSP00000498495; ENSG00000177138

Database of genes from NCBI RefSeq genomes

More...GeneIDi		171483

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:171483

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000327220.10; ENSP00000318716.5; NM_205849.3; NP_995321.1

UCSC genome browser

More...UCSCi		uc004csh.4, human [Q8IZU0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF494344 mRNA Translation: AAN07163.1
AK097501 mRNA Translation: BAC05078.1
AC074281 Genomic DNA No translation available.
AC119567 Genomic DNA No translation available.
AC119618 Genomic DNA No translation available.
CH471074 Genomic DNA Translation: EAW98763.1
BC120955 mRNA Translation: AAI20956.1
BC120956 mRNA Translation: AAI20957.1
CCDSiCCDS14132.1 [Q8IZU0-1]
RefSeqiNP_995321.1, NM_205849.3 [Q8IZU0-1]
XP_011543766.1, XM_011545464.2

3D structure databases

SMRiQ8IZU0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi128131, 167 interactors
IntActiQ8IZU0, 138 interactors
STRINGi9606.ENSP00000318716

Protein family/group databases

MoonDBiQ8IZU0, Predicted

Genetic variation databases

BioMutaiFAM9B
DMDMi29336758

Proteomic databases

jPOSTiQ8IZU0
MassIVEiQ8IZU0
PaxDbiQ8IZU0
PeptideAtlasiQ8IZU0
PRIDEiQ8IZU0

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		23614, 29 antibodies from 13 providers

The DNASU plasmid repository

More...DNASUi		171483

Genome annotation databases

EnsembliENST00000327220; ENSP00000318716; ENSG00000177138
ENST00000362066; ENSP00000354770; ENSG00000177138 [Q8IZU0-2]
ENST00000428477; ENSP00000412606; ENSG00000177138
ENST00000472522; ENSP00000431456; ENSG00000177138
ENST00000651278; ENSP00000498495; ENSG00000177138
GeneIDi171483
KEGGihsa:171483
MANE-SelectiENST00000327220.10; ENSP00000318716.5; NM_205849.3; NP_995321.1
UCSCiuc004csh.4, human [Q8IZU0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		171483

GeneCards: human genes, protein and diseases

More...GeneCardsi		FAM9B
HGNCiHGNC:18404, FAM9B
HPAiENSG00000177138, Tissue enhanced (liver, testis)
MIMi300478, gene
neXtProtiNX_Q8IZU0
OpenTargetsiENSG00000177138
PharmGKBiPA27993
VEuPathDBiHostDB:ENSG00000177138

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502TD36, Eukaryota
GeneTreeiENSGT00390000000062
HOGENOMiCLU_083208_0_0_1
InParanoidiQ8IZU0
OMAiRMKMDKA
OrthoDBi1187915at2759
PhylomeDBiQ8IZU0
TreeFamiTF328876

Enzyme and pathway databases

PathwayCommonsiQ8IZU0
SignaLinkiQ8IZU0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		171483, 12 hits in 655 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FAM9B, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		171483
PharosiQ8IZU0, Tdark

Protein Ontology

More...PROi		PR:Q8IZU0
RNActiQ8IZU0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000177138, Expressed in testis and 58 other tissues
ExpressionAtlasiQ8IZU0, baseline and differential
GenevisibleiQ8IZU0, HS

Family and domain databases

InterProiView protein in InterPro
IPR006888, XLR/SYCP3/FAM9_dom
PfamiView protein in Pfam
PF04803, Cor1, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFAM9B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IZU0
Secondary accession number(s): Q0IJ68, Q8N7Z8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 1, 2003
Last modified: February 23, 2022
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again