Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myocardin

Gene

MYOCD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage (myogenesis) (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

SIGNORiQ8IZQ8

Names & Taxonomyi

Protein namesi
Recommended name:
Myocardin
Gene namesi
Name:MYOCD
Synonyms:MYCD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000141052.17
HGNCiHGNC:16067 MYOCD
MIMi606127 gene
neXtProtiNX_Q8IZQ8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi93649
OpenTargetsiENSG00000141052
PharmGKBiPA134946896

Polymorphism and mutation databases

BioMutaiMYOCD
DMDMi32363335

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001266311 – 938MyocardinAdd BLAST938

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei451Phosphoserine; by GSK3-betaBy similarity1
Modified residuei455Phosphoserine; by GSK3-betaBy similarity1
Modified residuei459Phosphoserine; by GSK3-betaBy similarity1
Modified residuei463Phosphoserine; by GSK3-betaBy similarity1
Modified residuei626Phosphoserine; by GSK3-betaBy similarity1
Modified residuei630Phosphoserine; by GSK3-betaBy similarity1
Modified residuei634Phosphoserine; by GSK3-betaBy similarity1
Modified residuei638Phosphoserine; by GSK3-betaBy similarity1
Modified residuei815Phosphoserine; by MAPK1 AND MAPK3By similarity1
Modified residuei862Phosphoserine; by MAPK1 and MAPK3By similarity1
Modified residuei869Phosphoserine; by MAPK1 and MAPK3By similarity1
Modified residuei896Phosphothreonine; by MAPK1 and MAPK3By similarity1

Post-translational modificationi

Phosphorylation regulates negatively the intrinsic myocardin transcriptional activity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8IZQ8
PaxDbiQ8IZQ8
PeptideAtlasiQ8IZQ8
PRIDEiQ8IZQ8
ProteomicsDBi71407
71408 [Q8IZQ8-2]
71409 [Q8IZQ8-3]

PTM databases

iPTMnetiQ8IZQ8
PhosphoSitePlusiQ8IZQ8

Expressioni

Tissue specificityi

Expressed in heart, aorta, and in smooth muscle cell-containing tissues: stomach, bladder, small intestine, colon, lung, placenta and uterus. Very faint expression in prostate and skeletal muscle.2 Publications

Inductioni

Up-regulated during heart failure.1 Publication

Gene expression databases

BgeeiENSG00000141052 Expressed in 139 organ(s), highest expression level in cauda epididymis
CleanExiHS_MYOCD
ExpressionAtlasiQ8IZQ8 baseline and differential
GenevisibleiQ8IZQ8 HS

Organism-specific databases

HPAiCAB046485

Interactioni

Subunit structurei

Homodimer. Interacts with SRF, its association does not depend on specific DNA sequences for ternary complex formation (By similarity). Interacts with MLLT7/FOXO4. Interacts (via C-terminal) with EP300 (via the CREB-binding domain). Interacts with HDAC4 and HDAC5 (By similarity). Interacts with MEF2C (By similarity).By similarity

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi125044, 14 interactors
CORUMiQ8IZQ8
IntActiQ8IZQ8, 3 interactors
STRINGi9606.ENSP00000401678

Structurei

3D structure databases

ProteinModelPortaliQ8IZQ8
SMRiQ8IZQ8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati18 – 43RPEL 1Add BLAST26
Repeati62 – 87RPEL 2Add BLAST26
Repeati106 – 131RPEL 3Add BLAST26
Domaini371 – 405SAPPROSITE-ProRule annotationAdd BLAST35

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni153 – 205HDAC5-bindingBy similarityAdd BLAST53

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili516 – 561Sequence analysisAdd BLAST46

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi12 – 27MEF2C-bindingBy similarityAdd BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi291 – 322Gln-richAdd BLAST32
Compositional biasi435 – 508Ser-richAdd BLAST74

Domaini

The C-terminal region contains a general transcription activation domain. The N-terminal region, comprising a basic and a Gln-rich domain, confers transcriptional potency and specificity by mediating association with the MADS box of SRF. The basic domain may be required for nuclear localization. The SAP domain is important for transactivation and ternary complex formation (By similarity).By similarity

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IE2C Eukaryota
ENOG410XNR1 LUCA
GeneTreeiENSGT00530000063195
HOGENOMiHOG000038001
HOVERGENiHBG036493
InParanoidiQ8IZQ8
KOiK22526
OMAiCPKSPGV
OrthoDBiEOG091G02RT
PhylomeDBiQ8IZQ8
TreeFamiTF326024

Family and domain databases

Gene3Di1.10.720.30, 1 hit
InterProiView protein in InterPro
IPR028721 MYOCD
IPR004018 RPEL_repeat
IPR003034 SAP_dom
IPR036361 SAP_dom_sf
PANTHERiPTHR22793:SF11 PTHR22793:SF11, 1 hit
PfamiView protein in Pfam
PF02755 RPEL, 1 hit
PF02037 SAP, 1 hit
SMARTiView protein in SMART
SM00707 RPEL, 3 hits
SM00513 SAP, 1 hit
SUPFAMiSSF68906 SSF68906, 1 hit
PROSITEiView protein in PROSITE
PS51073 RPEL, 3 hits
PS50800 SAP, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IZQ8-1) [UniParc]FASTAAdd to basket
Also known as: Myocardin-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTLLGSEHSL LIRSKFRSVL QLRLQQRRTQ EQLANQGIIP PLKRPAEFHE
60 70 80 90 100
QRKHLDSDKA KNSLKRKARN RCNSADLVNM HILQASTAER SIPTAQMKLK
110 120 130 140 150
RARLADDLNE KIALRPGPLE LVEKNILPVD SAVKEAIKGN QVSFSKSTDA
160 170 180 190 200
FAFEEDSSSD GLSPDQTRSE DPQNSAGSPP DAKASDTPST GSLGTNQDLA
210 220 230 240 250
SGSENDRNDS ASQPSHQSDA GKQGLGPPST PIAVHAAVKS KSLGDSKNRH
260 270 280 290 300
KKPKDPKPKV KKLKYHQYIP PDQKAEKSPP PMDSAYARLL QQQQLFLQLQ
310 320 330 340 350
ILSQQQQQQQ HRFSYLGMHQ AQLKEPNEQM VRNPNSSSTP LSNTPLSPVK
360 370 380 390 400
NSFSGQTGVS SFKPGPLPPN LDDLKVSELR QQLRIRGLPV SGTKTALMDR
410 420 430 440 450
LRPFQDCSGN PVPNFGDITT VTFPVTPNTL PNYQSSSSTS ALSNGFYHFG
460 470 480 490 500
STSSSPPISP ASSDLSVAGS LPDTFNDASP SFGLHPSPVH VCTEESLMSS
510 520 530 540 550
LNGGSVPSEL DGLDSEKDKM LVEKQKVINE LTWKLQQEQR QVEELRMQLQ
560 570 580 590 600
KQKRNNCSEK KPLPFLAASI KQEEAVSSCP FASQVPVKRQ SSSSECHPPA
610 620 630 640 650
CEAAQLQPLG NAHCVESSDQ TNVLSSTFLS PQCSPQHSPL GAVKSPQHIS
660 670 680 690 700
LPPSPNNPHF LPSSSGAQGE GHRVSSPISS QVCTAQMAGL HSSDKVGPKF
710 720 730 740 750
SIPSPTFSKS SSAISEVTQP PSYEDAVKQQ MTRSQQMDEL LDVLIESGEM
760 770 780 790 800
PADAREDHSC LQKVPKIPRS SRSPTAVLTK PSASFEQASS GSQIPFDPYA
810 820 830 840 850
TDSDEHLEVL LNSQSPLGKM SDVTLLKIGS EEPHFDGIMD GFSGKAAEDL
860 870 880 890 900
FNAHEILPGP LSPMQTQFSP SSVDSNGLQL SFTESPWETM EWLDLTPPNS
910 920 930
TPGFSALTTS SPSIFNIDFL DVTDLNLNSS MDLHLQQW
Length:938
Mass (Da):101,997
Last modified:March 1, 2003 - v1
Checksum:i295F66A02725B0A5
GO
Isoform 2 (identifier: Q8IZQ8-2) [UniParc]FASTAAdd to basket
Also known as: Myocardin-C

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK
     730-732: QMT → VTM
     733-938: Missing.

Note: No experimental confirmation available.
Show »
Length:684
Mass (Da):73,183
Checksum:i78D7F120161A7626
GO
Isoform 3 (identifier: Q8IZQ8-3) [UniParc]FASTAAdd to basket
Also known as: Myocardin-B

The sequence of this isoform differs from the canonical sequence as follows:
     686-686: Q → QNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQK

Show »
Length:986
Mass (Da):106,769
Checksum:i4FF5FCD468EEB86F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6N065Q6N065_HUMAN
Myocardin
MYOCD DKFZp686O15128
648Annotation score:
J3KSX3J3KSX3_HUMAN
Myocardin
MYOCD
41Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0076581 – 96Missing in isoform 2. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_007659686Q → QNSGAHDGHPPSFSPHSSSL HPPFSGAQADSSHGAGGNPC PKSPCVQQK in isoform 2 and isoform 3. 4 Publications1
Alternative sequenceiVSP_007660730 – 732QMT → VTM in isoform 2. 1 Publication3
Alternative sequenceiVSP_007661733 – 938Missing in isoform 2. 1 PublicationAdd BLAST206

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF532596 mRNA Translation: AAN33040.1
AY764180 mRNA Translation: AAV33439.1
AK292885 mRNA Translation: BAF85574.1
AK097821 mRNA Translation: BAC05177.1
AC005358 Genomic DNA No translation available.
BC126307 mRNA Translation: AAI26308.1
BC143391 mRNA Translation: AAI43392.1
CCDSiCCDS11163.1 [Q8IZQ8-1]
CCDS54091.1 [Q8IZQ8-3]
RefSeqiNP_001139784.1, NM_001146312.2 [Q8IZQ8-3]
NP_705832.1, NM_153604.3 [Q8IZQ8-1]
UniGeneiHs.462257
Hs.567641

Genome annotation databases

EnsembliENST00000343344; ENSP00000341835; ENSG00000141052 [Q8IZQ8-1]
ENST00000425538; ENSP00000401678; ENSG00000141052 [Q8IZQ8-3]
GeneIDi93649
KEGGihsa:93649
UCSCiuc002gnn.4 human [Q8IZQ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF532596 mRNA Translation: AAN33040.1
AY764180 mRNA Translation: AAV33439.1
AK292885 mRNA Translation: BAF85574.1
AK097821 mRNA Translation: BAC05177.1
AC005358 Genomic DNA No translation available.
BC126307 mRNA Translation: AAI26308.1
BC143391 mRNA Translation: AAI43392.1
CCDSiCCDS11163.1 [Q8IZQ8-1]
CCDS54091.1 [Q8IZQ8-3]
RefSeqiNP_001139784.1, NM_001146312.2 [Q8IZQ8-3]
NP_705832.1, NM_153604.3 [Q8IZQ8-1]
UniGeneiHs.462257
Hs.567641

3D structure databases

ProteinModelPortaliQ8IZQ8
SMRiQ8IZQ8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125044, 14 interactors
CORUMiQ8IZQ8
IntActiQ8IZQ8, 3 interactors
STRINGi9606.ENSP00000401678

PTM databases

iPTMnetiQ8IZQ8
PhosphoSitePlusiQ8IZQ8

Polymorphism and mutation databases

BioMutaiMYOCD
DMDMi32363335

Proteomic databases

MaxQBiQ8IZQ8
PaxDbiQ8IZQ8
PeptideAtlasiQ8IZQ8
PRIDEiQ8IZQ8
ProteomicsDBi71407
71408 [Q8IZQ8-2]
71409 [Q8IZQ8-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343344; ENSP00000341835; ENSG00000141052 [Q8IZQ8-1]
ENST00000425538; ENSP00000401678; ENSG00000141052 [Q8IZQ8-3]
GeneIDi93649
KEGGihsa:93649
UCSCiuc002gnn.4 human [Q8IZQ8-1]

Organism-specific databases

CTDi93649
DisGeNETi93649
EuPathDBiHostDB:ENSG00000141052.17
GeneCardsiMYOCD
H-InvDBiHIX0027347
HGNCiHGNC:16067 MYOCD
HPAiCAB046485
MIMi606127 gene
neXtProtiNX_Q8IZQ8
OpenTargetsiENSG00000141052
PharmGKBiPA134946896
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE2C Eukaryota
ENOG410XNR1 LUCA
GeneTreeiENSGT00530000063195
HOGENOMiHOG000038001
HOVERGENiHBG036493
InParanoidiQ8IZQ8
KOiK22526
OMAiCPKSPGV
OrthoDBiEOG091G02RT
PhylomeDBiQ8IZQ8
TreeFamiTF326024

Enzyme and pathway databases

SIGNORiQ8IZQ8

Miscellaneous databases

GeneWikiiMYOCD
GenomeRNAii93649
PROiPR:Q8IZQ8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000141052 Expressed in 139 organ(s), highest expression level in cauda epididymis
CleanExiHS_MYOCD
ExpressionAtlasiQ8IZQ8 baseline and differential
GenevisibleiQ8IZQ8 HS

Family and domain databases

Gene3Di1.10.720.30, 1 hit
InterProiView protein in InterPro
IPR028721 MYOCD
IPR004018 RPEL_repeat
IPR003034 SAP_dom
IPR036361 SAP_dom_sf
PANTHERiPTHR22793:SF11 PTHR22793:SF11, 1 hit
PfamiView protein in Pfam
PF02755 RPEL, 1 hit
PF02037 SAP, 1 hit
SMARTiView protein in SMART
SM00707 RPEL, 3 hits
SM00513 SAP, 1 hit
SUPFAMiSSF68906 SSF68906, 1 hit
PROSITEiView protein in PROSITE
PS51073 RPEL, 3 hits
PS50800 SAP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMYCD_HUMAN
AccessioniPrimary (citable) accession number: Q8IZQ8
Secondary accession number(s): Q5UBU5, Q8N7Q1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2003
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again