Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adhesion G-protein coupled receptor F3

Gene

ADGRF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Orphan receptor.

GO - Molecular functioni

  • G protein-coupled receptor activity Source: GDB

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPSiP02.028

Names & Taxonomyi

Protein namesi
Recommended name:
Adhesion G-protein coupled receptor F3
Alternative name(s):
G-protein coupled receptor 113
G-protein coupled receptor PGR23
Gene namesi
Name:ADGRF3
Synonyms:GPR113, PGR23
ORF Names:UNQ9196/PRO34000
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000173567.14
HGNCiHGNC:18989 ADGRF3
neXtProtiNX_Q8IZF5

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini26 – 775ExtracellularCuratedAdd BLAST750
Transmembranei776 – 796Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini797 – 811CytoplasmicCuratedAdd BLAST15
Transmembranei812 – 832Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini833 – 851ExtracellularCuratedAdd BLAST19
Transmembranei852 – 874Helical; Name=3Sequence analysisAdd BLAST23
Topological domaini875 – 881CytoplasmicCurated7
Transmembranei882 – 902Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini903 – 928ExtracellularCuratedAdd BLAST26
Transmembranei929 – 949Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini950 – 973CytoplasmicCuratedAdd BLAST24
Transmembranei974 – 994Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini995 – 1002ExtracellularCurated8
Transmembranei1003 – 1023Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini1024 – 1079CytoplasmicCuratedAdd BLAST56

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi165082
OpenTargetsiENSG00000173567
PharmGKBiPA134918027

Polymorphism and mutation databases

BioMutaiGPR113
DMDMi59797951

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
ChainiPRO_000001289326 – 1079Adhesion G-protein coupled receptor F3Add BLAST1054

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi188N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi264N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi301N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi382N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi441N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi648N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8IZF5
PaxDbiQ8IZF5
PRIDEiQ8IZF5
ProteomicsDBi71343
71344 [Q8IZF5-2]

PTM databases

iPTMnetiQ8IZF5
PhosphoSitePlusiQ8IZF5

Expressioni

Gene expression databases

BgeeiENSG00000173567 Expressed in 84 organ(s), highest expression level in left adrenal gland
CleanExiHS_GPR113
ExpressionAtlasiQ8IZF5 baseline and differential
GenevisibleiQ8IZF5 HS

Organism-specific databases

HPAiHPA044500

Interactioni

Protein-protein interaction databases

BioGridi127907, 2 interactors
STRINGi9606.ENSP00000307831

Structurei

3D structure databases

ProteinModelPortaliQ8IZF5
SMRiQ8IZF5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini712 – 764GPSPROSITE-ProRule annotationAdd BLAST53

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4193 Eukaryota
ENOG410XSD2 LUCA
GeneTreeiENSGT00930000150821
HOGENOMiHOG000112763
HOVERGENiHBG051770
InParanoidiQ8IZF5
KOiK08456
OMAiFGCLMDK
OrthoDBiEOG091G022O
PhylomeDBiQ8IZF5
TreeFamiTF316380

Family and domain databases

Gene3Di4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF01825 GPS, 1 hit
PF02793 HRM, 1 hit
PRINTSiPR00249 GPCRSECRETIN
SMARTiView protein in SMART
SM00303 GPS, 1 hit
SUPFAMiSSF111418 SSF111418, 1 hit
PROSITEiView protein in PROSITE
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IZF5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVCSAAPLLL LATTLPLLGS PVAQASQPVS ETGVRPREGL QRRQWGPLIG
60 70 80 90 100
RDKAWNERID RPFPACPIPL SSSFGRWPKG QTMWAQTSTL TLTEEELGQS
110 120 130 140 150
QAGGESGSGQ LLDQENGAGE SALVSVYVHL DFPDKTWPPE LSRTLTLPAA
160 170 180 190 200
SASSSPRPLL TGLRLTTECN VNHKGNFYCA CLSGYQWNTS ICLHYPPCQS
210 220 230 240 250
LHNHQPCGCL VFSHPEPGYC QLLPPGSPVT CLPAVPGILN LNSQLQMPGD
260 270 280 290 300
TLSLTLHLSQ EATNLSWFLR HPGSPSPILL QPGTQVSVTS SHGQAALSVS
310 320 330 340 350
NMSHHWAGEY MSCFEAQGFK WNLYEVVRVP LKATDVARLP YQLSISCATS
360 370 380 390 400
PGFQLSCCIP STNLAYTAAW SPGEGSKASS FNESGSQCFV LAVQRCPMAD
410 420 430 440 450
TTYACDLQSL GLAPLRVPIS ITIIQDGDIT CPEDASVLTW NVTKAGHVAQ
460 470 480 490 500
APCPESKRGI VRRLCGADGV WGPVHSSCTD ARLLALFTRT KLLQAGQGSP
510 520 530 540 550
AEEVPQILAQ LPGQAAEASS PSDLLTLLST MKYVAKVVAE ARIQLDRRAL
560 570 580 590 600
KNLLIATDKV LDMDTRSLWT LAQARKPWAG STLLLAVETL ACSLCPQDHP
610 620 630 640 650
FAFSLPNVLL QSQLFGPTFP ADYSISFPTR PPLQAQIPRH SLAPLVRNGT
660 670 680 690 700
EISITSLVLR KLDHLLPSNY GQGLGDSLYA TPGLVLVISI MAGDRAFSQG
710 720 730 740 750
EVIMDFGNTD GSPHCVFWDH SLFQGRGGWS KEGCQAQVAS ASPTAQCLCQ
760 770 780 790 800
HLTAFSVLMS PHTVPEEPAL ALLTQVGLGA SILALLVCLG VYWLVWRVVV
810 820 830 840 850
RNKISYFRHA ALLNMVFCLL AADTCFLGAP FLSPGPRSPL CLAAAFLCHF
860 870 880 890 900
LYLATFFWML AQALVLAHQL LFVFHQLAKH RVLPLMVLLG YLCPLGLAGV
910 920 930 940 950
TLGLYLPQGQ YLREGECWLD GKGGALYTFV GPVLAIIGVN GLVLAMAMLK
960 970 980 990 1000
LLRPSLSEGP PAEKRQALLG VIKALLILTP IFGLTWGLGL ATLLEEVSTV
1010 1020 1030 1040 1050
PHYIFTILNT LQGVFILLFG CLMDRKIQEA LRKRFCRAQA PSSTISLVSC
1060 1070
CLQILSCASK SMSEGIPWPS SEDMGTARS
Length:1,079
Mass (Da):116,341
Last modified:March 1, 2003 - v1
Checksum:iA18CA158F4DDBB9C
GO
Isoform 2 (identifier: Q8IZF5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-97: MVCSAAPLLL...STLTLTEEEL → MTTRKLSAHS...RMAKTGLPEK
     168-307: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTARKTDASE

Show »
Length:873
Mass (Da):93,912
Checksum:i03A8E3E3AEEDE1C8
GO
Isoform 3 (identifier: Q8IZF5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-97: Missing.
     1048-1079: VSCCLQILSCASKSMSEGIPWPSSEDMGTARS → ATNEGCILEHSKGGSDTAR

Note: No experimental confirmation available.
Show »
Length:997
Mass (Da):107,020
Checksum:i3319FE1B2BBDB3B3
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WE87F8WE87_HUMAN
Adhesion G-protein-coupled receptor...
ADGRF3
120Annotation score:
C9JSE8C9JSE8_HUMAN
Adhesion G-protein-coupled receptor...
ADGRF3
87Annotation score:

Sequence cautioni

The sequence BAB89332 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC45265 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti348A → V in AAQ88539 (PubMed:12975309).Curated1
Sequence conflicti599H → Y in AAQ88539 (PubMed:12975309).Curated1
Sequence conflicti765P → S in BAG57276 (PubMed:14702039).Curated1
Sequence conflicti886M → T in AAQ88581 (PubMed:12975309).Curated1
Isoform 2 (identifier: Q8IZF5-2)
Sequence conflicti868K → N in AAQ88581 (PubMed:12975309).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024475404A → T1 PublicationCorresponds to variant dbSNP:rs2052937Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128151 – 97MVCSA…TEEEL → MTTRKLSAHSAATPGYKAVT HKHHTGWARMAKTGLPEK in isoform 2. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_04617429 – 97Missing in isoform 3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_012816168 – 307Missing in isoform 2. 1 PublicationAdd BLAST140
Alternative sequenceiVSP_0128171048 – 1079VSCCL…GTARS → ATNEGCILEHSKGGSDTARK TDASE in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0461751048 – 1079VSCCL…GTARS → ATNEGCILEHSKGGSDTAR in isoform 3. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY140955 mRNA Translation: AAN46669.1
AB065959 Genomic DNA Translation: BAC45265.1 Sequence problems.
AY358172 mRNA Translation: AAQ88539.1
AY358214 Transcribed RNA Translation: AAQ88581.1
AB083619 Genomic DNA Translation: BAB89332.1 Different initiation.
AK293887 mRNA Translation: BAG57276.1
AC010896 Genomic DNA Translation: AAY14645.1
AY255611 mRNA Translation: AAO85123.1
CCDSiCCDS33159.2 [Q8IZF5-2]
CCDS46238.1 [Q8IZF5-3]
CCDS46239.1 [Q8IZF5-1]
RefSeqiNP_001138640.1, NM_001145168.1 [Q8IZF5-1]
NP_001138641.1, NM_001145169.1 [Q8IZF5-3]
NP_001308900.1, NM_001321971.1
NP_001308904.1, NM_001321975.1
NP_722577.2, NM_153835.3 [Q8IZF5-2]
UniGeneiHs.631878

Genome annotation databases

EnsembliENST00000311519; ENSP00000307831; ENSG00000173567 [Q8IZF5-1]
ENST00000333478; ENSP00000327396; ENSG00000173567 [Q8IZF5-2]
ENST00000421160; ENSP00000388537; ENSG00000173567 [Q8IZF5-3]
ENST00000447444; ENSP00000404775; ENSG00000173567 [Q8IZF5-2]
GeneIDi165082
KEGGihsa:165082
UCSCiuc002rhd.2 human [Q8IZF5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY140955 mRNA Translation: AAN46669.1
AB065959 Genomic DNA Translation: BAC45265.1 Sequence problems.
AY358172 mRNA Translation: AAQ88539.1
AY358214 Transcribed RNA Translation: AAQ88581.1
AB083619 Genomic DNA Translation: BAB89332.1 Different initiation.
AK293887 mRNA Translation: BAG57276.1
AC010896 Genomic DNA Translation: AAY14645.1
AY255611 mRNA Translation: AAO85123.1
CCDSiCCDS33159.2 [Q8IZF5-2]
CCDS46238.1 [Q8IZF5-3]
CCDS46239.1 [Q8IZF5-1]
RefSeqiNP_001138640.1, NM_001145168.1 [Q8IZF5-1]
NP_001138641.1, NM_001145169.1 [Q8IZF5-3]
NP_001308900.1, NM_001321971.1
NP_001308904.1, NM_001321975.1
NP_722577.2, NM_153835.3 [Q8IZF5-2]
UniGeneiHs.631878

3D structure databases

ProteinModelPortaliQ8IZF5
SMRiQ8IZF5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127907, 2 interactors
STRINGi9606.ENSP00000307831

Protein family/group databases

MEROPSiP02.028
GPCRDBiSearch...

PTM databases

iPTMnetiQ8IZF5
PhosphoSitePlusiQ8IZF5

Polymorphism and mutation databases

BioMutaiGPR113
DMDMi59797951

Proteomic databases

MaxQBiQ8IZF5
PaxDbiQ8IZF5
PRIDEiQ8IZF5
ProteomicsDBi71343
71344 [Q8IZF5-2]

Protocols and materials databases

DNASUi165082
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311519; ENSP00000307831; ENSG00000173567 [Q8IZF5-1]
ENST00000333478; ENSP00000327396; ENSG00000173567 [Q8IZF5-2]
ENST00000421160; ENSP00000388537; ENSG00000173567 [Q8IZF5-3]
ENST00000447444; ENSP00000404775; ENSG00000173567 [Q8IZF5-2]
GeneIDi165082
KEGGihsa:165082
UCSCiuc002rhd.2 human [Q8IZF5-1]

Organism-specific databases

CTDi165082
DisGeNETi165082
EuPathDBiHostDB:ENSG00000173567.14
GeneCardsiADGRF3
HGNCiHGNC:18989 ADGRF3
HPAiHPA044500
neXtProtiNX_Q8IZF5
OpenTargetsiENSG00000173567
PharmGKBiPA134918027
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4193 Eukaryota
ENOG410XSD2 LUCA
GeneTreeiENSGT00930000150821
HOGENOMiHOG000112763
HOVERGENiHBG051770
InParanoidiQ8IZF5
KOiK08456
OMAiFGCLMDK
OrthoDBiEOG091G022O
PhylomeDBiQ8IZF5
TreeFamiTF316380

Miscellaneous databases

GeneWikiiGPR113
GenomeRNAii165082
PROiPR:Q8IZF5

Gene expression databases

BgeeiENSG00000173567 Expressed in 84 organ(s), highest expression level in left adrenal gland
CleanExiHS_GPR113
ExpressionAtlasiQ8IZF5 baseline and differential
GenevisibleiQ8IZF5 HS

Family and domain databases

Gene3Di4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF01825 GPS, 1 hit
PF02793 HRM, 1 hit
PRINTSiPR00249 GPCRSECRETIN
SMARTiView protein in SMART
SM00303 GPS, 1 hit
SUPFAMiSSF111418 SSF111418, 1 hit
PROSITEiView protein in PROSITE
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiAGRF3_HUMAN
AccessioniPrimary (citable) accession number: Q8IZF5
Secondary accession number(s): B4DF15
, E9PEV1, Q53TA5, Q6UXT7, Q6UXX3, Q86SL7, Q8IXD8, Q8TDT3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again