Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (31 Jul 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Phosphatase and actin regulator 4

Gene

PHACTR4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of protein phosphatase 1 (PP1) required for neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development. Acts as an activator of PP1 by interacting with PPP1CA and preventing phosphorylation of PPP1CA at 'Thr-320'. During neural tube closure, localizes to the ventral neural tube and activates PP1, leading to down-regulate cell proliferation within cranial neural tissue and the neural retina. Also acts as a regulator of migration of enteric neural crest cells (ENCCs) by activating PP1, leading to dephosphorylation and subsequent activation of cofilin (COF1 or COF2) and repression of the integrin signaling through the RHO/ROCK pathway (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Developmental protein
Biological processNeurogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatase and actin regulator 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PHACTR4
ORF Names:PRO2963
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25793 PHACTR4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608726 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IZ21

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000204138

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134959472

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PHACTR4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74728415

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002873061 – 702Phosphatase and actin regulator 4Add BLAST702

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei116PhosphoserineBy similarity1
Modified residuei118PhosphoserineCombined sources1
Modified residuei131PhosphoserineCombined sources1
Modified residuei147PhosphoserineCombined sources1
Modified residuei270PhosphoserineBy similarity1
Modified residuei291PhosphoserineCombined sources1
Modified residuei342PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei358PhosphothreonineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei432PhosphothreonineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei453PhosphoserineBy similarity1
Modified residuei464PhosphoserineCombined sources1
Modified residuei514PhosphoserineBy similarity1
Modified residuei516PhosphoserineBy similarity1
Modified residuei557PhosphoserineCombined sources1
Modified residuei590PhosphoserineCombined sources1
Modified residuei628PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IZ21

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IZ21

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IZ21

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IZ21

PeptideAtlas

More...
PeptideAtlasi
Q8IZ21

PRoteomics IDEntifications database

More...
PRIDEi
Q8IZ21

ProteomicsDB human proteome resource

More...
ProteomicsDBi
71271 [Q8IZ21-1]
71272 [Q8IZ21-2]
71273 [Q8IZ21-3]
71274 [Q8IZ21-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IZ21

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IZ21

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q8IZ21

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204138 Expressed in 220 organ(s), highest expression level in mouth mucosa

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IZ21 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IZ21 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028985

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds PPP1CA and actin.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122429, 31 interactors

Database of interacting proteins

More...
DIPi
DIP-47323N

Protein interaction database and analysis system

More...
IntActi
Q8IZ21, 17 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362942

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IZ21

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati63 – 88RPEL 1Add BLAST26
Repeati583 – 608RPEL 2Add BLAST26
Repeati621 – 646RPEL 3Add BLAST26

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi227 – 433Pro-richAdd BLAST207
Compositional biasi478 – 482Poly-Glu5
Compositional biasi508 – 513Poly-Glu6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMQR Eukaryota
ENOG4111W4B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157582

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IZ21

KEGG Orthology (KO)

More...
KOi
K17585

Identification of Orthologs from Complete Genome Data

More...
OMAi
HSFGEPH

Database of Orthologous Groups

More...
OrthoDBi
1205245at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IZ21

TreeFam database of animal gene trees

More...
TreeFami
TF316316

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029984 Phactr4
IPR004018 RPEL_repeat

The PANTHER Classification System

More...
PANTHERi
PTHR12751:SF4 PTHR12751:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02755 RPEL, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00707 RPEL, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51073 RPEL, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IZ21-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDPFEEADQ PTTEPGMVLD SVEAGDTTPP TKRKSKFSGF GKIFKPWKWR
60 70 80 90 100
KKKSSDKFKE TSEVLERKIS MRKPREELVK RGVLLEDPEQ GGEDPGKPSD
110 120 130 140 150
AMLKNGHTTP IGNARSSSPV QVEEEPVRLA SLRKAIPEED LKKRLGSTGS
160 170 180 190 200
QPNSEAESVP ENVPKPPLLP PKRPLSSSHE ASEGQAKDAT SSGGTARFII
210 220 230 240 250
STSITTAPAA TTAATSLAKT VNLSVTPSPA PRTLPAAPAS TNTTATPSLT
260 270 280 290 300
HMVPAKQPPI PPPKPAHRNS NPVIAELSQA INSGTLLSKP SPPLPPKRGI
310 320 330 340 350
PSTSVPTLES AAAITTKTPS DEREKSTCSM GSELLPMISP RSPSPPLPTH
360 370 380 390 400
IPPEPPRTPP FPAKTFQVVP EIEFPPSLDL HQEIPQQEDQ KKEVPKRILD
410 420 430 440 450
QNFGEPHIPS RLPPLPLHIR IQQALTSPLP MTPILEGSHR AHSLLFENSD
460 470 480 490 500
SFSEDSSTLG RTRSLPITIE MLKVPDDEEE EEQTCPSTFS EEMTPTSVIP
510 520 530 540 550
KLPQCLREEE EKESDSDSEG PIQYRDEEDE DESYQSALAN KVKRKDTLAM
560 570 580 590 600
KLNHRPSEPE LNLNSWPCKS KEEWNEIRHQ IGNTLIRRLS QRPTPEELEQ
610 620 630 640 650
RNILQPKNEA DRQAEKREIK RRLTRKLSQR PTVAELLARK ILRFNEYVEV
660 670 680 690 700
TDAQDYDRRA DKPWTKLTPA DKAAIRKELN EFKSSEMEVH EESKHFTRYH

RP
Length:702
Mass (Da):78,211
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i89AC6A1D08411948
GO
Isoform 2 (identifier: Q8IZ21-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MEDPF → MGQADVSRPVNPDAV

Show »
Length:712
Mass (Da):79,129
Checksum:i3F9C6DE318A7B2F0
GO
Isoform 3 (identifier: Q8IZ21-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:686
Mass (Da):76,436
Checksum:iD08F12D5D26DB362
GO
Isoform 4 (identifier: Q8IZ21-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     6-6: E → DFSREPWNSRGSRPAHYRARHGPGQCGSRRHNTSYQKEEQVLRLWQDLQALEMEEKKK
     7-702: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:63
Mass (Da):7,586
Checksum:iC71BB87679575723
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0J9YVR0A0A0J9YVR0_HUMAN
Phosphatase and actin regulator
PHACTR4
221Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YWV8A0A0J9YWV8_HUMAN
Phosphatase and actin regulator
PHACTR4
106Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0J9YY52A0A0J9YY52_HUMAN
Phosphatase and actin regulator 4
PHACTR4
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG35507 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH68508 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAB14483 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB15130 differs from that shown. Reason: Frameshift at position 51.Curated
The sequence CAH18286 differs from that shown. Reason: Frameshift at position 53.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti183E → G in CAH18286 (PubMed:17974005).Curated1
Sequence conflicti459L → P in BAB14483 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0254361 – 16Missing in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_0254371 – 5MEDPF → MGQADVSRPVNPDAV in isoform 2. 1 Publication5
Alternative sequenceiVSP_0397306E → DFSREPWNSRGSRPAHYRAR HGPGQCGSRRHNTSYQKEEQ VLRLWQDLQALEMEEKKK in isoform 4. 1 Publication1
Alternative sequenceiVSP_0397317 – 702Missing in isoform 4. 1 PublicationAdd BLAST696

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK023233 mRNA Translation: BAB14483.1 Different initiation.
AK025436 mRNA Translation: BAB15130.1 Frameshift.
CR749449 mRNA Translation: CAH18286.1 Frameshift.
AL360012 Genomic DNA No translation available.
AL670471 Genomic DNA No translation available.
CR391992 Genomic DNA No translation available.
CR589951 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07696.1
CH471059 Genomic DNA Translation: EAX07698.1
BC021247 mRNA Translation: AAH21247.3
BC029266 mRNA Translation: AAH29266.1
BC068508 mRNA Translation: AAH68508.1 Sequence problems.
AF130081 mRNA Translation: AAG35507.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41293.1 [Q8IZ21-1]
CCDS41294.1 [Q8IZ21-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001041648.1, NM_001048183.1 [Q8IZ21-1]
NP_076412.3, NM_023923.3 [Q8IZ21-2]
XP_016857657.1, XM_017002168.1
XP_016857662.1, XM_017002173.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373836; ENSP00000362942; ENSG00000204138 [Q8IZ21-2]
ENST00000373839; ENSP00000362945; ENSG00000204138 [Q8IZ21-1]
ENST00000493669; ENSP00000488359; ENSG00000204138 [Q8IZ21-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65979

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65979

UCSC genome browser

More...
UCSCi
uc001bpw.4 human [Q8IZ21-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023233 mRNA Translation: BAB14483.1 Different initiation.
AK025436 mRNA Translation: BAB15130.1 Frameshift.
CR749449 mRNA Translation: CAH18286.1 Frameshift.
AL360012 Genomic DNA No translation available.
AL670471 Genomic DNA No translation available.
CR391992 Genomic DNA No translation available.
CR589951 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07696.1
CH471059 Genomic DNA Translation: EAX07698.1
BC021247 mRNA Translation: AAH21247.3
BC029266 mRNA Translation: AAH29266.1
BC068508 mRNA Translation: AAH68508.1 Sequence problems.
AF130081 mRNA Translation: AAG35507.1 Different initiation.
CCDSiCCDS41293.1 [Q8IZ21-1]
CCDS41294.1 [Q8IZ21-2]
RefSeqiNP_001041648.1, NM_001048183.1 [Q8IZ21-1]
NP_076412.3, NM_023923.3 [Q8IZ21-2]
XP_016857657.1, XM_017002168.1
XP_016857662.1, XM_017002173.1

3D structure databases

SMRiQ8IZ21
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122429, 31 interactors
DIPiDIP-47323N
IntActiQ8IZ21, 17 interactors
STRINGi9606.ENSP00000362942

PTM databases

iPTMnetiQ8IZ21
PhosphoSitePlusiQ8IZ21

Polymorphism and mutation databases

BioMutaiPHACTR4
DMDMi74728415

Proteomic databases

EPDiQ8IZ21
jPOSTiQ8IZ21
MaxQBiQ8IZ21
PaxDbiQ8IZ21
PeptideAtlasiQ8IZ21
PRIDEiQ8IZ21
ProteomicsDBi71271 [Q8IZ21-1]
71272 [Q8IZ21-2]
71273 [Q8IZ21-3]
71274 [Q8IZ21-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
65979
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373836; ENSP00000362942; ENSG00000204138 [Q8IZ21-2]
ENST00000373839; ENSP00000362945; ENSG00000204138 [Q8IZ21-1]
ENST00000493669; ENSP00000488359; ENSG00000204138 [Q8IZ21-4]
GeneIDi65979
KEGGihsa:65979
UCSCiuc001bpw.4 human [Q8IZ21-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65979

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PHACTR4
HGNCiHGNC:25793 PHACTR4
HPAiHPA028985
MIMi608726 gene
neXtProtiNX_Q8IZ21
OpenTargetsiENSG00000204138
PharmGKBiPA134959472

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IMQR Eukaryota
ENOG4111W4B LUCA
GeneTreeiENSGT00940000157582
InParanoidiQ8IZ21
KOiK17585
OMAiHSFGEPH
OrthoDBi1205245at2759
PhylomeDBiQ8IZ21
TreeFamiTF316316

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PHACTR4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65979
PMAP-CutDBiQ8IZ21

Protein Ontology

More...
PROi
PR:Q8IZ21

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204138 Expressed in 220 organ(s), highest expression level in mouth mucosa
ExpressionAtlasiQ8IZ21 baseline and differential
GenevisibleiQ8IZ21 HS

Family and domain databases

InterProiView protein in InterPro
IPR029984 Phactr4
IPR004018 RPEL_repeat
PANTHERiPTHR12751:SF4 PTHR12751:SF4, 1 hit
PfamiView protein in Pfam
PF02755 RPEL, 3 hits
SMARTiView protein in SMART
SM00707 RPEL, 3 hits
PROSITEiView protein in PROSITE
PS51073 RPEL, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHAR4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IZ21
Secondary accession number(s): A2APK6
, B9ZVW0, D3DPM3, Q68DD4, Q6NUN6, Q8N384, Q9H395, Q9H6X0, Q9H8W6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: March 1, 2003
Last modified: July 31, 2019
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again