Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8IYS2 (K2013_HUMAN)

Entry version 128 (02 Jun 2021)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Uncharacterized protein KIAA2013

Gene

KIAA2013

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8IYS2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein KIAA2013
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIAA2013
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28513, KIAA2013

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8IYS2

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000116685.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini41 – 589ExtracellularSequence analysisAdd BLAST549
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei590 – 610HelicalSequence analysisAdd BLAST21
Topological domaini611 – 634CytoplasmicSequence analysisAdd BLAST24

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		90231

Open Targets

More...OpenTargetsi		ENSG00000116685

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671593

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8IYS2, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KIAA2013

Domain mapping of disease mutations (DMDM)

More...DMDMi		74750773

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 40Sequence analysisAdd BLAST40
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000029346841 – 634Uncharacterized protein KIAA2013Add BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi363N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8IYS2

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8IYS2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8IYS2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8IYS2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8IYS2

PeptideAtlas

More...PeptideAtlasi		Q8IYS2

PRoteomics IDEntifications database

More...PRIDEi		Q8IYS2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		71221 [Q8IYS2-1]
71222 [Q8IYS2-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q8IYS2, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8IYS2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8IYS2

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8IYS2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000116685, Expressed in placenta and 223 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8IYS2, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000116685, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124680, 72 interactors

Protein interaction database and analysis system

More...IntActi		Q8IYS2, 56 interactors

Molecular INTeraction database

More...MINTi		Q8IYS2

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000365756

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8IYS2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3778, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000007643

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_023338_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8IYS2

Identification of Orthologs from Complete Genome Data

More...OMAi		HKHGHQL

Database of Orthologous Groups

More...OrthoDBi		882934at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8IYS2

TreeFam database of animal gene trees

More...TreeFami		TF314999

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018795, DUF2152

The PANTHER Classification System

More...PANTHERi		PTHR31386, PTHR31386, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8IYS2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWLQQRLKGL PGLLSSSWAR RLLCLLGLLL LLLWFGGSGA RRAAGGLHLL 
        60         70         80         90        100
PWSRGEPGAA EPSACLEAAT RAWRGLRERG EVVPLGPGVP ALVANGFLAL 
       110        120        130        140        150
DVAANRLWVT PGEREPAVAP DFVPFVQLRP LSALAEAGEA VLLLREGLLR 
       160        170        180        190        200
RVRCLQLGSP GPGPVAAGPG PASVSGLAAG SGRDCVLLQE DFLAHRGRPH 
       210        220        230        240        250
VYLQRIQLNN PTERVAALQT VGPTAGPAPK AFTSTLEKVG DHQFLLYSGR 
       260        270        280        290        300
SPPTPTGLVH LVVVAAKKLV NRLQVAPKTQ LDETVLWVVH VSGPINPQVL 
       310        320        330        340        350
KSKAAKELKA LQDLARKEML ELLDMPAAEL LQDHQLLWAQ LFSPGVEMKK 
       360        370        380        390        400
ITDTHTPSGL TVNLTLYYML SCSPAPLLSP SLSHRERDQM ESTLNYEDHC 
       410        420        430        440        450
FSGHATMHAE NLWPGRLSSV QQILQLSDLW RLTLQKRGCK GLVKVGAPGI 
       460        470        480        490        500
LQGMVLSFGG LQFTENHLQF QADPDVLHNS YALHGIRYKN DHINLAVLAD 
       510        520        530        540        550
AEGKPYLHVS VESRGQPVKI YACKAGCLDE PVELTSAPTG HTFSVMVTQP 
       560        570        580        590        600
ITPLLYISTD LTHLQDLRHT LHLKAILAHD EHMAQQDPGL PFLFWFSVAS 
       610        620        630 
LITLFHLFLF KLIYNEYCGP GAKPLFRSKE DPSV
Length:634
Mass (Da):69,157
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCC63D7B1CDB33C5E
GO
Isoform 2 (identifier: Q8IYS2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     630-634: EDPSV → VGSRHLVETRGLGLALSPVSRKGLAWRGGVRPGQEWVS

Show »
Length:667
Mass (Da):72,681
Checksum:i6070CE966A25458C
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC23109 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_026487630 – 634EDPSV → VGSRHLVETRGLGLALSPVS RKGLAWRGGVRPGQEWVS in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB095933 mRNA Translation: BAC23109.1 Different initiation.
AL096840 Genomic DNA No translation available.
AL021155 Genomic DNA No translation available.
BC004501 mRNA Translation: AAH04501.2
BC035033 mRNA Translation: AAH35033.1
AL833891 mRNA Translation: CAD38747.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS141.1 [Q8IYS2-1]

NCBI Reference Sequences

More...RefSeqi		NP_612355.1, NM_138346.2 [Q8IYS2-1]
XP_005263588.1, XM_005263531.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000376572; ENSP00000365756; ENSG00000116685 [Q8IYS2-1]
ENST00000376576; ENSP00000365760; ENSG00000116685 [Q8IYS2-2]
ENST00000616327; ENSP00000480577; ENSG00000116685 [Q8IYS2-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		90231

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:90231

UCSC genome browser

More...UCSCi		uc001atk.4, human [Q8IYS2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095933 mRNA Translation: BAC23109.1 Different initiation.
AL096840 Genomic DNA No translation available.
AL021155 Genomic DNA No translation available.
BC004501 mRNA Translation: AAH04501.2
BC035033 mRNA Translation: AAH35033.1
AL833891 mRNA Translation: CAD38747.1
CCDSiCCDS141.1 [Q8IYS2-1]
RefSeqiNP_612355.1, NM_138346.2 [Q8IYS2-1]
XP_005263588.1, XM_005263531.4

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi124680, 72 interactors
IntActiQ8IYS2, 56 interactors
MINTiQ8IYS2
STRINGi9606.ENSP00000365756

PTM databases

GlyGeniQ8IYS2, 1 site
iPTMnetiQ8IYS2
PhosphoSitePlusiQ8IYS2
SwissPalmiQ8IYS2

Genetic variation databases

BioMutaiKIAA2013
DMDMi74750773

Proteomic databases

EPDiQ8IYS2
jPOSTiQ8IYS2
MassIVEiQ8IYS2
MaxQBiQ8IYS2
PaxDbiQ8IYS2
PeptideAtlasiQ8IYS2
PRIDEiQ8IYS2
ProteomicsDBi71221 [Q8IYS2-1]
71222 [Q8IYS2-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		65397, 35 antibodies

The DNASU plasmid repository

More...DNASUi		90231

Genome annotation databases

EnsembliENST00000376572; ENSP00000365756; ENSG00000116685 [Q8IYS2-1]
ENST00000376576; ENSP00000365760; ENSG00000116685 [Q8IYS2-2]
ENST00000616327; ENSP00000480577; ENSG00000116685 [Q8IYS2-1]
GeneIDi90231
KEGGihsa:90231
UCSCiuc001atk.4, human [Q8IYS2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		90231
DisGeNETi90231

GeneCards: human genes, protein and diseases

More...GeneCardsi		KIAA2013
HGNCiHGNC:28513, KIAA2013
HPAiENSG00000116685, Low tissue specificity
neXtProtiNX_Q8IYS2
OpenTargetsiENSG00000116685
PharmGKBiPA142671593
VEuPathDBiHostDB:ENSG00000116685.15

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3778, Eukaryota
GeneTreeiENSGT00390000007643
HOGENOMiCLU_023338_0_0_1
InParanoidiQ8IYS2
OMAiHKHGHQL
OrthoDBi882934at2759
PhylomeDBiQ8IYS2
TreeFamiTF314999

Enzyme and pathway databases

PathwayCommonsiQ8IYS2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		90231, 31 hits in 997 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KIAA2013, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		90231
PharosiQ8IYS2, Tdark

Protein Ontology

More...PROi		PR:Q8IYS2
RNActiQ8IYS2, protein

Gene expression databases

BgeeiENSG00000116685, Expressed in placenta and 223 other tissues
GenevisibleiQ8IYS2, HS

Family and domain databases

InterProiView protein in InterPro
IPR018795, DUF2152
PANTHERiPTHR31386, PTHR31386, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK2013_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IYS2
Secondary accession number(s): Q5JXC1
, Q8IVF8, Q8NDI7, Q9BSY1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: March 1, 2003
Last modified: June 2, 2021
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again