Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (08 May 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

MICAL-like protein 2

Gene

MICALL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Effector of small Rab GTPases which is involved in junctional complexes assembly through the regulation of cell adhesion molecules transport to the plasma membrane and actin cytoskeleton reorganization. Regulates the endocytic recycling of occludins, claudins and E-cadherin to the plasma membrane and may thereby regulate the establishment of tight junctions and adherens junctions. In parallel, may regulate actin cytoskeleton reorganization directly through interaction with F-actin or indirectly through actinins and filamins. Most probably involved in the processes of epithelial cell differentiation, cell spreading and neurite outgrowth (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MICAL-like protein 2
Alternative name(s):
Junctional Rab13-binding protein
Molecule interacting with CasL-like 2
Short name:
MICAL-L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MICALL2
Synonyms:JRAB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29672 MICALL2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IY33

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Endosome, Membrane, Tight junction

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79778

MalaCards human disease database

More...
MalaCardsi
MICALL2

Open Targets

More...
OpenTargetsi
ENSG00000164877

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162395928

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MICALL2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
46396456

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758501 – 904MICAL-like protein 2Add BLAST904

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei110PhosphoserineCombined sources1
Modified residuei143PhosphoserineCombined sources1
Modified residuei153PhosphoserineCombined sources1
Modified residuei249PhosphoserineCombined sources1
Modified residuei294PhosphoserineCombined sources1
Modified residuei494PhosphoserineCombined sources1
Modified residuei504PhosphoserineCombined sources1
Modified residuei598PhosphoserineCombined sources1
Modified residuei644PhosphothreonineCombined sources1
Modified residuei649PhosphoserineCombined sources1
Modified residuei658PhosphoserineCombined sources1
Modified residuei660PhosphoserineCombined sources1
Modified residuei726PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IY33

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IY33

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IY33

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IY33

PeptideAtlas

More...
PeptideAtlasi
Q8IY33

PRoteomics IDEntifications database

More...
PRIDEi
Q8IY33

ProteomicsDB human proteome resource

More...
ProteomicsDBi
71097
71098 [Q8IY33-2]
71099 [Q8IY33-3]
71100 [Q8IY33-4]
71101 [Q8IY33-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IY33

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IY33

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164877 Expressed in 160 organ(s), highest expression level in tibial nerve

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IY33 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA025695

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAB13 (GTP-bound form); competes with RAB8A and is involved in tight junctions assembly. Interacts with RAB8A; competes with RAB13 and is involved in E-cadherin endocytic recycling (By similarity). Interacts with RAB8B (By similarity). Interacts (preferentially in opened conformation) with ACTN1 and ACTN4; stimulated by RAB13 activation (By similarity). Interacts (via calponin-homology (CH) domain) with the filamins FLNA, FLNB and FLNC (via actin-binding domain).By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122879, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q8IY33, 16 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000297508

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IY33

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 107Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST107
Domaini186 – 248LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST63
Domaini723 – 874bMERBPROSITE-ProRule annotationAdd BLAST152

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 260Forms an intramolecular interaction with the C-terminal coiled coil domain keeping the protein in a closed conformationBy similarityAdd BLAST260
Regioni261 – 697Mediates targeting to the cell plasma membraneBy similarityAdd BLAST437
Regioni261 – 388Necessary and sufficient for interaction with actininsBy similarityAdd BLAST128
Regioni698 – 807Forms an intramolecular interaction with the N-terminal Calponin-homology and LIM zinc-binding domains-containing region keeping the protein in a closed conformationBy similarityAdd BLAST110
Regioni807 – 903Mediates interaction with RAB13 and is required for transition from the closed to the opened conformationBy similarityAdd BLAST97

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili735 – 771Sequence analysisAdd BLAST37

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi356 – 359Poly-Ala4
Compositional biasi392 – 397Poly-Ser6
Compositional biasi663 – 666Poly-Arg4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Probably exists in a closed and an opened conformation due to interaction of the C-terminal coiled-coil domain with an N-terminal region including the calponin-homology (CH) and the LIM zinc-binding domain. The conformational change is regulated by RAB13 (By similarity).By similarity

Keywords - Domaini

Coiled coil, LIM domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKSW Eukaryota
COG5069 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160222

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290690

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IY33

KEGG Orthology (KO)

More...
KOi
K21068

Identification of Orthologs from Complete Genome Data

More...
OMAi
DWFQLIH

Database of Orthologous Groups

More...
OrthoDBi
377701at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IY33

TreeFam database of animal gene trees

More...
TreeFami
TF328311

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00014 CH, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022735 bMERB_dom
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR028563 MICAL-L
IPR001781 Znf_LIM

The PANTHER Classification System

More...
PANTHERi
PTHR23167:SF53 PTHR23167:SF53, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307 CH, 1 hit
PF12130 DUF3585, 1 hit
PF00412 LIM, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033 CH, 1 hit
SM00132 LIM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47576 SSF47576, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51848 BMERB, 1 hit
PS50021 CH, 1 hit
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8IY33-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAIRALQQW CRQQCEGYRD VNICNMTTSF RDGLAFCAIL HRHRPDLINF
60 70 80 90 100
SALKKENIYE NNKLAFRVAE EHLGIPALLD AEDMVALKVP DRLSILTYVS
110 120 130 140 150
QYYNYFHGRS PIGGMAGVKR ASEDSEEEPS GKKAPVQAAK LPSPAPARKP
160 170 180 190 200
PLSPAQTNPV VQRRNEGAGG PPPKTDQALA GSLVSSTCGV CGKHVHLVQR
210 220 230 240 250
HLADGRLYHR SCFRCKQCSC TLHSGAYKAT GEPGTFVCTS HLPAAASASP
260 270 280 290 300
KLTGLVPRQP GAMGVDSRTS CSPQKAQEAN KARPSAWEPA AGNSPARASV
310 320 330 340 350
PAAPNPAATS ATSVHVRSPA RPSESRLAPT PTEGKVRPRV TNSSPMGWSS
360 370 380 390 400
AAPCTAAAAS HPAVPPSAPD PRPATPQGGG APRVAAPQTT LSSSSTSAAT
410 420 430 440 450
VDPPAWTPSA SRTQQARNKF FQTSAVPPGT SLSGRGPTPS LVLSKDSSKE
460 470 480 490 500
QARNFLKQAL SALEEAGAPA PGRPSPATAA VPSSQPKTEA PQASPLAKPL
510 520 530 540 550
QSSSPRVLGL PSRMEPPAPL STSSTSQASA LPPAGRRNLA ESSGVGRVGA
560 570 580 590 600
GSRPKPEAPM AKGKSTTLTQ DMSTSLQEGQ EDGPAGWRAN LKPVDRRSPA
610 620 630 640 650
ERTLKPKEPR ALAEPRAGEA PRKVSGSFAG SVHITLTPVR PDRTPRPASP
660 670 680 690 700
GPSLPARSPS PPRRRRLAVP ASLDVCDNWL RPEPPGQEAR VQSWKEEEKK
710 720 730 740 750
PHLQGKPGRP LSPANVPALP GETVTSPVRL HPDYLSPEEI QRQLQDIERR
760 770 780 790 800
LDALELRGVE LEKRLRAAEG DDAEDSLMVD WFWLIHEKQL LLRQESELMY
810 820 830 840 850
KSKAQRLEEQ QLDIEGELRR LMAKPEALKS LQERRREQEL LEQYVSTVND
860 870 880 890 900
RSDIVDSLDE DRLREQEEDQ MLRDMIEKLG LQRKKSKFRL SKIWSPKSKS

SPSQ
Length:904
Mass (Da):97,502
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA2C360EDDEFFA2EF
GO
Isoform 2 (identifier: Q8IY33-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLI → MFLSSR
     656-904: ARSPSPPRRR...SPKSKSSPSQ → GPPPHPAAGD...PMSLLCLARR

Note: No experimental confirmation available.
Show »
Length:680
Mass (Da):70,848
Checksum:i3996713704E4671D
GO
Isoform 3 (identifier: Q8IY33-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-570: MAAIRALQQW...AKGKSTTLTQ → MALSSWAQGT...LTPRPLASHP

Note: No experimental confirmation available.
Show »
Length:493
Mass (Da):55,298
Checksum:i9C6DB62BD33BF923
GO
Isoform 4 (identifier: Q8IY33-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     571-904: DMSTSLQEGQ...SPKSKSSPSQ → GE

Note: No experimental confirmation available.
Show »
Length:572
Mass (Da):59,484
Checksum:iB4A270575A51A4A4
GO
Isoform 5 (identifier: Q8IY33-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-240: Missing.

Note: No experimental confirmation available.
Show »
Length:692
Mass (Da):74,527
Checksum:iC449383F5CD5A47F
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15667 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB84894 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti255L → M in CAD98087 (Ref. 1) Curated1
Sequence conflicti285S → L in BAB15667 (PubMed:14702039).Curated1
Sequence conflicti706K → R in BAB15667 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034071480A → P. Corresponds to variant dbSNP:rs12540098Ensembl.1
Natural variantiVAR_034072519P → L. Corresponds to variant dbSNP:rs4075307Ensembl.1
Natural variantiVAR_061356623K → R. Corresponds to variant dbSNP:rs61287564Ensembl.1
Natural variantiVAR_050159711L → V. Corresponds to variant dbSNP:rs11980797Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0098561 – 570MAAIR…TTLTQ → MALSSWAQGTSWAAKGFSRS FSLAEFSLLKPRAGSCRTQE PRKPADGQPWLRCSPCTGGQ RIWVHGAHPATSPPIRQKGK LRPRGRESFPQGHTAQESQL GAPPLTPCPVLLMPPGRLAV GVSEGGVAMGRWQGEAQPPL QTPHSQHSFLTPRPLASHP in isoform 3. 1 PublicationAdd BLAST570
Alternative sequenceiVSP_0098541 – 48MAAIR…RPDLI → MFLSSR in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_00985829 – 240Missing in isoform 5. 1 PublicationAdd BLAST212
Alternative sequenceiVSP_009857571 – 904DMSTS…SSPSQ → GE in isoform 4. 1 PublicationAdd BLAST334
Alternative sequenceiVSP_009855656 – 904ARSPS…SSPSQ → GPPPHPAAGDWPSLPASTFV TTGFGRSPLARKPECRAGRR RRRNLTFRANQGDPCPRPMS LLCLARR in isoform 2. 1 PublicationAdd BLAST249

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL833704 mRNA Translation: CAD98087.1
AK027124 mRNA Translation: BAB15667.1 Different initiation.
AK126808 mRNA Translation: BAC86702.1
AK074068 mRNA Translation: BAB84894.1 Different initiation.
AC102953 Genomic DNA No translation available.
CH471144 Genomic DNA Translation: EAW87200.1
BC037988 mRNA Translation: AAH37988.1
BK000467 mRNA Translation: DAA01346.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5324.1 [Q8IY33-1]

NCBI Reference Sequences

More...
RefSeqi
NP_891554.1, NM_182924.3 [Q8IY33-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297508; ENSP00000297508; ENSG00000164877 [Q8IY33-1]
ENST00000413446; ENSP00000405415; ENSG00000164877 [Q8IY33-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79778

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79778

UCSC genome browser

More...
UCSCi
uc003skj.5 human [Q8IY33-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL833704 mRNA Translation: CAD98087.1
AK027124 mRNA Translation: BAB15667.1 Different initiation.
AK126808 mRNA Translation: BAC86702.1
AK074068 mRNA Translation: BAB84894.1 Different initiation.
AC102953 Genomic DNA No translation available.
CH471144 Genomic DNA Translation: EAW87200.1
BC037988 mRNA Translation: AAH37988.1
BK000467 mRNA Translation: DAA01346.1
CCDSiCCDS5324.1 [Q8IY33-1]
RefSeqiNP_891554.1, NM_182924.3 [Q8IY33-1]

3D structure databases

SMRiQ8IY33
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122879, 11 interactors
IntActiQ8IY33, 16 interactors
STRINGi9606.ENSP00000297508

PTM databases

iPTMnetiQ8IY33
PhosphoSitePlusiQ8IY33

Polymorphism and mutation databases

BioMutaiMICALL2
DMDMi46396456

Proteomic databases

EPDiQ8IY33
jPOSTiQ8IY33
MaxQBiQ8IY33
PaxDbiQ8IY33
PeptideAtlasiQ8IY33
PRIDEiQ8IY33
ProteomicsDBi71097
71098 [Q8IY33-2]
71099 [Q8IY33-3]
71100 [Q8IY33-4]
71101 [Q8IY33-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
79778
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297508; ENSP00000297508; ENSG00000164877 [Q8IY33-1]
ENST00000413446; ENSP00000405415; ENSG00000164877 [Q8IY33-2]
GeneIDi79778
KEGGihsa:79778
UCSCiuc003skj.5 human [Q8IY33-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79778
DisGeNETi79778

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MICALL2
HGNCiHGNC:29672 MICALL2
HPAiHPA025695
MalaCardsiMICALL2
neXtProtiNX_Q8IY33
OpenTargetsiENSG00000164877
PharmGKBiPA162395928

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKSW Eukaryota
COG5069 LUCA
GeneTreeiENSGT00940000160222
HOGENOMiHOG000290690
InParanoidiQ8IY33
KOiK21068
OMAiDWFQLIH
OrthoDBi377701at2759
PhylomeDBiQ8IY33
TreeFamiTF328311

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MICALL2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79778

Protein Ontology

More...
PROi
PR:Q8IY33

Gene expression databases

BgeeiENSG00000164877 Expressed in 160 organ(s), highest expression level in tibial nerve
GenevisibleiQ8IY33 HS

Family and domain databases

CDDicd00014 CH, 1 hit
Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR022735 bMERB_dom
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR028563 MICAL-L
IPR001781 Znf_LIM
PANTHERiPTHR23167:SF53 PTHR23167:SF53, 1 hit
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF12130 DUF3585, 1 hit
PF00412 LIM, 1 hit
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00132 LIM, 1 hit
SUPFAMiSSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS51848 BMERB, 1 hit
PS50021 CH, 1 hit
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMILK2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IY33
Secondary accession number(s): D3YTD2
, Q7RTP4, Q7Z655, Q8TEQ4, Q9H5F9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: March 1, 2003
Last modified: May 8, 2019
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again