Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8IXI2 (MIRO1_HUMAN)

Entry version 156 (13 Feb 2019)
Sequence version 2 (13 Jun 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Mitochondrial Rho GTPase 1

Gene

RHOT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi11 – 18GTP 18
Nucleotide bindingi57 – 61GTP 1Sequence analysis5
Nucleotide bindingi118 – 121GTP 1Sequence analysis4
<p>This subsection of the ‘Function’ section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi197 – 2081CuratedAdd BLAST12
Calcium bindingi317 – 3282CuratedAdd BLAST12
Nucleotide bindingi425 – 432GTP 28
Nucleotide bindingi463 – 467GTP 2Sequence analysis5
Nucleotide bindingi527 – 530GTP 2Sequence analysis4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • GTPase activity Source: GO_Central
  • GTP binding Source: GO_Central
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandCalcium, GTP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-194840 Rho GTPase cycle
R-HSA-5689880 Ub-specific processing proteases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mitochondrial Rho GTPase 1 (EC:3.6.5.-)
Short name:
MIRO-1
Short name:
hMiro-1
Alternative name(s):
Rac-GTP-binding protein-like protein
Ras homolog gene family member T1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RHOT1
Synonyms:ARHT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000126858.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:21168 RHOT1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613888 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8IXI2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 592Mitochondrial intermembraneSequence analysisAdd BLAST592
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei593 – 615Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST23
Topological domaini616 – 618CytoplasmicSequence analysis3

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi13P → V: Causes constitutive activation inducing an aggregation of the mitochondrial network. 3 Publications1
Mutagenesisi18T → N: Causes constitutive inactivation. 2 Publications1
Mutagenesisi208E → K: Abolishes the formation of thread-like mitochondria. 1 Publication1
Mutagenesisi328E → K: Abolishes the formation of thread-like mitochondria. 1 Publication1
Mutagenesisi427K → V: No effect. 1 Publication1
Mutagenesisi432S → N: No effect. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		55288

Open Targets

More...OpenTargetsi		ENSG00000126858

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134906318

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RHOT1

Domain mapping of disease mutations (DMDM)

More...DMDMi		108860796

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002393131 – 618Mitochondrial Rho GTPase 1Add BLAST618

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8IXI2

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8IXI2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8IXI2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8IXI2

PeptideAtlas

More...PeptideAtlasi		Q8IXI2

PRoteomics IDEntifications database

More...PRIDEi		Q8IXI2

ProteomicsDB human proteome resource

More...ProteomicsDBi		71002
71003 [Q8IXI2-2]
71004 [Q8IXI2-3]
71005 [Q8IXI2-4]
71006 [Q8IXI2-5]
71007 [Q8IXI2-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8IXI2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8IXI2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000126858 Expressed in 235 organ(s), highest expression level in substantia nigra

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8IXI2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8IXI2 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB068223
CAB068224
HPA010687

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the kinesin-binding proteins TRAK1/OIP106 and TRAK2/GRIF1, forming a link between mitochondria and the trafficking apparatus of the microtubules (PubMed:16630562). Interacts with ARMCX1 (By similarity). Found in a complex with KIF5B, OGT, RHOT2 and TRAK1 (PubMed:24995978).By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		120576, 18 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8IXI2

Database of interacting proteins

More...DIPi		DIP-39114N

Protein interaction database and analysis system

More...IntActi		Q8IXI2, 19 interactors

Molecular INTeraction database

More...MINTi		Q8IXI2

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000351132

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1618
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KSOX-ray2.25A411-592[»]
5KSPX-ray2.16A/B411-592[»]
5KSYX-ray2.48A411-592[»]
5KSZX-ray2.50A177-592[»]
5KTYX-ray2.52A177-592[»]
5KU1X-ray2.50A177-592[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q8IXI2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8IXI2

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 177Miro 1Add BLAST177
Domaini184 – 219EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini304 – 339EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini412 – 561Miro 2Add BLAST150

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the mitochondrial Rho GTPase family.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1707 Eukaryota
ENOG410XRHW LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155641

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG079778

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8IXI2

KEGG Orthology (KO)

More...KOi		K07870

Identification of Orthologs from Complete Genome Data

More...OMAi		CSAKTLH

Database of Orthologous Groups

More...OrthoDBi		538388at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8IXI2

TreeFam database of animal gene trees

More...TreeFami		TF300814

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR013566 EF_hand_assoc_1
IPR013567 EF_hand_assoc_2
IPR002048 EF_hand_dom
IPR021181 Miro
IPR020860 MIRO_dom
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08355 EF_assoc_1, 1 hit
PF08356 EF_assoc_2, 1 hit
PF00071 Ras, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF037488 Mt_Rho_GTPase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00054 EFh, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473 SSF47473, 1 hit
SSF52540 SSF52540, 2 hits

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00231 small_GTP, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS51423 MIRO, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IXI2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKKDVRILLV GEPRVGKTSL IMSLVSEEFP EEVPPRAEEI TIPADVTPER 
        60         70         80         90        100
VPTHIVDYSE AEQSDEQLHQ EISQANVICI VYAVNNKHSI DKVTSRWIPL 
       110        120        130        140        150
INERTDKDSR LPLILVGNKS DLVEYSSMET ILPIMNQYTE IETCVECSAK 
       160        170        180        190        200
NLKNISELFY YAQKAVLHPT GPLYCPEEKE MKPACIKALT RIFKISDQDN 
       210        220        230        240        250
DGTLNDAELN FFQRICFNTP LAPQALEDVK NVVRKHISDG VADSGLTLKG 
       260        270        280        290        300
FLFLHTLFIQ RGRHETTWTV LRRFGYDDDL DLTPEYLFPL LKIPPDCTTE 
       310        320        330        340        350
LNHHAYLFLQ STFDKHDLDR DCALSPDELK DLFKVFPYIP WGPDVNNTVC 
       360        370        380        390        400
TNERGWITYQ GFLSQWTLTT YLDVQRCLEY LGYLGYSILT EQESQASAVT 
       410        420        430        440        450
VTRDKKIDLQ KKQTQRNVFR CNVIGVKNCG KSGVLQALLG RNLMRQKKIR 
       460        470        480        490        500
EDHKSYYAIN TVYVYGQEKY LLLHDISESE FLTEAEIICD VVCLVYDVSN 
       510        520        530        540        550
PKSFEYCARI FKQHFMDSRI PCLIVAAKSD LHEVKQEYSI SPTDFCRKHK 
       560        570        580        590        600
MPPPQAFTCN TADAPSKDIF VKLTTMAMYP HVTQADLKSS TFWLRASFGA 
       610 
TVFAVLGFAM YKALLKQR
Length:618
Mass (Da):70,784
Last modified:June 13, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFE47AC3A4AF6F6C2
GO
Isoform 2 (identifier: Q8IXI2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAL

Show »
Length:650
Mass (Da):74,752
Checksum:i9E2A92E79F9160E1
GO
Isoform 3 (identifier: Q8IXI2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAFHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:691
Mass (Da):79,547
Checksum:i478FF7C2F8DD1986
GO
Isoform 4 (identifier: Q8IXI2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-618: Missing.

Note: No experimental confirmation available.
Show »
Length:580
Mass (Da):66,541
Checksum:iEC42DCCD95811BC3
GO
Isoform 5 (identifier: Q8IXI2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     582-618: VTQADLKSST...AMYKALLKQR → ARLRCMCTCN...TAVLNRIISA

Note: No experimental confirmation available.
Show »
Length:625
Mass (Da):71,687
Checksum:i3968C61EE9945024
GO
Isoform 6 (identifier: Q8IXI2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-247: QALEDVKNVVRKHISDGVADSGLT → RFGFEQVLVLLFLQFWALLCTKHY
     248-618: Missing.

Note: No experimental confirmation available.
Show »
Length:247
Mass (Da):28,265
Checksum:i3802160B22935376
GO
Isoform 7 (identifier: Q8IXI2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Note: No experimental confirmation available.
Show »
Length:659
Mass (Da):75,546
Checksum:i82C8A91A753D656F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXZ6H7BXZ6_HUMAN
Mitochondrial Rho GTPase
RHOT1 hCG_1991479
597Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QSG2J3QSG2_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLG2J3QLG2_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EIQ7K7EIQ7_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EP86K7EP86_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSR5J3KSR5_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRG7J3KRG7_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y4I2A0A2R8Y4I2_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH41114 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH68463 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91969 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14185 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti75A → V in AAM15734 (Ref. 3) Curated1
Sequence conflicti246L → F in AAH60781 (PubMed:15489334).Curated1
Sequence conflicti246L → F in BAA91969 (PubMed:14702039).Curated1
Sequence conflicti331D → G in AAH60781 (PubMed:15489334).Curated1
Sequence conflicti587L → P in CAD56956 (PubMed:12482879).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_019153224 – 247QALED…DSGLT → RFGFEQVLVLLFLQFWALLC TKHY in isoform 6. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_019154248 – 618Missing in isoform 6. 1 PublicationAdd BLAST371
Alternative sequenceiVSP_019155580P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAL in isoform 2. 2 Publications1
Alternative sequenceiVSP_019156580P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAFHARLRCM CTCNRCTFCICQNFLNSDLL QSVKNKIFTAVLNR in isoform 3. 3 Publications1
Alternative sequenceiVSP_047651580P → PHARLRCMCTCNRCTFCICQ NFLNSDLLQSVKNKIFTAVL NR in isoform 7. Curated1
Alternative sequenceiVSP_019157581 – 618Missing in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_019158582 – 618VTQAD…LLKQR → ARLRCMCTCNRCTFCICQNF LNSDLLQSVKNKIFTAVLNR IISA in isoform 5. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ496730 mRNA Translation: CAD43139.1
AJ517412 mRNA Translation: CAD56956.1
AY094972 mRNA Translation: AAM15734.1
AL136929 mRNA Translation: CAB66863.1
AK001902 mRNA Translation: BAA91969.1 Different initiation.
AK022695 mRNA Translation: BAB14185.1 Different initiation.
AK294407 mRNA Translation: BAG57659.1
AC116407 Genomic DNA No translation available.
AC026620 Genomic DNA No translation available.
BC015698 mRNA Translation: AAH15698.1
BC041114 mRNA Translation: AAH41114.1 Different initiation.
BC051818 mRNA Translation: AAH51818.1
BC060781 mRNA Translation: AAH60781.2
BC068463 mRNA Translation: AAH68463.1 Different initiation.
BC125104 mRNA Translation: AAI25105.1
BC125105 mRNA Translation: AAI25106.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32610.1 [Q8IXI2-3]
CCDS32611.1 [Q8IXI2-7]
CCDS32612.1 [Q8IXI2-1]
CCDS74030.1 [Q8IXI2-2]

NCBI Reference Sequences

More...RefSeqi		NP_001028738.1, NM_001033566.2 [Q8IXI2-7]
NP_001028739.2, NM_001033567.2
NP_001028740.1, NM_001033568.2 [Q8IXI2-3]
NP_001275683.1, NM_001288754.1 [Q8IXI2-2]
NP_001275684.1, NM_001288755.1
NP_001275687.1, NM_001288758.1
NP_060777.3, NM_018307.4 [Q8IXI2-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.655325

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000333942; ENSP00000334724; ENSG00000126858 [Q8IXI2-1]
ENST00000358365; ENSP00000351132; ENSG00000126858 [Q8IXI2-3]
ENST00000394692; ENSP00000378184; ENSG00000126858 [Q8IXI2-2]
ENST00000545287; ENSP00000439737; ENSG00000126858 [Q8IXI2-7]
ENST00000581031; ENSP00000464094; ENSG00000126858 [Q8IXI2-5]
ENST00000581094; ENSP00000462669; ENSG00000126858 [Q8IXI2-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55288

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55288

UCSC genome browser

More...UCSCi		uc002hgv.4 human [Q8IXI2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496730 mRNA Translation: CAD43139.1
AJ517412 mRNA Translation: CAD56956.1
AY094972 mRNA Translation: AAM15734.1
AL136929 mRNA Translation: CAB66863.1
AK001902 mRNA Translation: BAA91969.1 Different initiation.
AK022695 mRNA Translation: BAB14185.1 Different initiation.
AK294407 mRNA Translation: BAG57659.1
AC116407 Genomic DNA No translation available.
AC026620 Genomic DNA No translation available.
BC015698 mRNA Translation: AAH15698.1
BC041114 mRNA Translation: AAH41114.1 Different initiation.
BC051818 mRNA Translation: AAH51818.1
BC060781 mRNA Translation: AAH60781.2
BC068463 mRNA Translation: AAH68463.1 Different initiation.
BC125104 mRNA Translation: AAI25105.1
BC125105 mRNA Translation: AAI25106.1
CCDSiCCDS32610.1 [Q8IXI2-3]
CCDS32611.1 [Q8IXI2-7]
CCDS32612.1 [Q8IXI2-1]
CCDS74030.1 [Q8IXI2-2]
RefSeqiNP_001028738.1, NM_001033566.2 [Q8IXI2-7]
NP_001028739.2, NM_001033567.2
NP_001028740.1, NM_001033568.2 [Q8IXI2-3]
NP_001275683.1, NM_001288754.1 [Q8IXI2-2]
NP_001275684.1, NM_001288755.1
NP_001275687.1, NM_001288758.1
NP_060777.3, NM_018307.4 [Q8IXI2-1]
UniGeneiHs.655325

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KSOX-ray2.25A411-592[»]
5KSPX-ray2.16A/B411-592[»]
5KSYX-ray2.48A411-592[»]
5KSZX-ray2.50A177-592[»]
5KTYX-ray2.52A177-592[»]
5KU1X-ray2.50A177-592[»]
ProteinModelPortaliQ8IXI2
SMRiQ8IXI2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120576, 18 interactors
CORUMiQ8IXI2
DIPiDIP-39114N
IntActiQ8IXI2, 19 interactors
MINTiQ8IXI2
STRINGi9606.ENSP00000351132

PTM databases

iPTMnetiQ8IXI2
PhosphoSitePlusiQ8IXI2

Polymorphism and mutation databases

BioMutaiRHOT1
DMDMi108860796

Proteomic databases

EPDiQ8IXI2
jPOSTiQ8IXI2
MaxQBiQ8IXI2
PaxDbiQ8IXI2
PeptideAtlasiQ8IXI2
PRIDEiQ8IXI2
ProteomicsDBi71002
71003 [Q8IXI2-2]
71004 [Q8IXI2-3]
71005 [Q8IXI2-4]
71006 [Q8IXI2-5]
71007 [Q8IXI2-6]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		55288
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000333942; ENSP00000334724; ENSG00000126858 [Q8IXI2-1]
ENST00000358365; ENSP00000351132; ENSG00000126858 [Q8IXI2-3]
ENST00000394692; ENSP00000378184; ENSG00000126858 [Q8IXI2-2]
ENST00000545287; ENSP00000439737; ENSG00000126858 [Q8IXI2-7]
ENST00000581031; ENSP00000464094; ENSG00000126858 [Q8IXI2-5]
ENST00000581094; ENSP00000462669; ENSG00000126858 [Q8IXI2-4]
GeneIDi55288
KEGGihsa:55288
UCSCiuc002hgv.4 human [Q8IXI2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55288
DisGeNETi55288
EuPathDBiHostDB:ENSG00000126858.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		RHOT1
HGNCiHGNC:21168 RHOT1
HPAiCAB068223
CAB068224
HPA010687
MIMi613888 gene
neXtProtiNX_Q8IXI2
OpenTargetsiENSG00000126858
PharmGKBiPA134906318

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1707 Eukaryota
ENOG410XRHW LUCA
GeneTreeiENSGT00940000155641
HOVERGENiHBG079778
InParanoidiQ8IXI2
KOiK07870
OMAiCSAKTLH
OrthoDBi538388at2759
PhylomeDBiQ8IXI2
TreeFamiTF300814

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
R-HSA-5689880 Ub-specific processing proteases

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RHOT1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RHOT1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55288

Protein Ontology

More...PROi		PR:Q8IXI2

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000126858 Expressed in 235 organ(s), highest expression level in substantia nigra
ExpressionAtlasiQ8IXI2 baseline and differential
GenevisibleiQ8IXI2 HS

Family and domain databases

InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR013566 EF_hand_assoc_1
IPR013567 EF_hand_assoc_2
IPR002048 EF_hand_dom
IPR021181 Miro
IPR020860 MIRO_dom
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF08355 EF_assoc_1, 1 hit
PF08356 EF_assoc_2, 1 hit
PF00071 Ras, 1 hit
PIRSFiPIRSF037488 Mt_Rho_GTPase, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
SSF52540 SSF52540, 2 hits
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS51423 MIRO, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMIRO1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IXI2
Secondary accession number(s): A4FVB6
, A6NFV0, B4DG48, J9JIH9, Q6NUR3, Q6P9F8, Q6PJG1, Q6YMW8, Q86UB0, Q8IW28, Q8IXJ7, Q9H067, Q9H9N8, Q9NUZ2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: February 13, 2019
This is version 156 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again