Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial Rho GTPase 1

Gene

RHOT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi11 – 18GTP 18
Nucleotide bindingi57 – 61GTP 1Sequence analysis5
Nucleotide bindingi118 – 121GTP 1Sequence analysis4
Calcium bindingi197 – 2081CuratedAdd BLAST12
Calcium bindingi317 – 3282CuratedAdd BLAST12
Nucleotide bindingi425 – 432GTP 28
Nucleotide bindingi463 – 467GTP 2Sequence analysis5
Nucleotide bindingi527 – 530GTP 2Sequence analysis4

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • GTPase activity Source: GO_Central
  • GTP binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionHydrolase
LigandCalcium, GTP-binding, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
R-HSA-5689880 Ub-specific processing proteases

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial Rho GTPase 1 (EC:3.6.5.-)
Short name:
MIRO-1
Short name:
hMiro-1
Alternative name(s):
Rac-GTP-binding protein-like protein
Ras homolog gene family member T1
Gene namesi
Name:RHOT1
Synonyms:ARHT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000126858.16
HGNCiHGNC:21168 RHOT1
MIMi613888 gene
neXtProtiNX_Q8IXI2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 592Mitochondrial intermembraneSequence analysisAdd BLAST592
Transmembranei593 – 615Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST23
Topological domaini616 – 618CytoplasmicSequence analysis3

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi13P → V: Causes constitutive activation inducing an aggregation of the mitochondrial network. 3 Publications1
Mutagenesisi18T → N: Causes constitutive inactivation. 2 Publications1
Mutagenesisi208E → K: Abolishes the formation of thread-like mitochondria. 1 Publication1
Mutagenesisi328E → K: Abolishes the formation of thread-like mitochondria. 1 Publication1
Mutagenesisi427K → V: No effect. 1 Publication1
Mutagenesisi432S → N: No effect. 1 Publication1

Organism-specific databases

DisGeNETi55288
OpenTargetsiENSG00000126858
PharmGKBiPA134906318

Polymorphism and mutation databases

DMDMi108860796

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002393131 – 618Mitochondrial Rho GTPase 1Add BLAST618

Post-translational modificationi

Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ8IXI2
MaxQBiQ8IXI2
PaxDbiQ8IXI2
PeptideAtlasiQ8IXI2
PRIDEiQ8IXI2
ProteomicsDBi71002
71003 [Q8IXI2-2]
71004 [Q8IXI2-3]
71005 [Q8IXI2-4]
71006 [Q8IXI2-5]
71007 [Q8IXI2-6]

PTM databases

iPTMnetiQ8IXI2
PhosphoSitePlusiQ8IXI2

Expressioni

Tissue specificityi

Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000126858 Expressed in 235 organ(s), highest expression level in substantia nigra
CleanExiHS_RHOT1
ExpressionAtlasiQ8IXI2 baseline and differential
GenevisibleiQ8IXI2 HS

Organism-specific databases

HPAiCAB068223
CAB068224
HPA010687

Interactioni

Subunit structurei

Interacts with the kinesin-binding proteins TRAK1/OIP106 and TRAK2/GRIF1, forming a link between mitochondria and the trafficking apparatus of the microtubules (PubMed:16630562). Interacts with ARMCX1 (By similarity). Found in a complex with KIF5B, OGT, RHOT2 and TRAK1 (PubMed:24995978).By similarity2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi120576, 18 interactors
DIPiDIP-39114N
IntActiQ8IXI2, 19 interactors
MINTiQ8IXI2
STRINGi9606.ENSP00000351132

Structurei

Secondary structure

1618
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8IXI2
SMRiQ8IXI2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 177Miro 1Add BLAST177
Domaini184 – 219EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini304 – 339EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini412 – 561Miro 2Add BLAST150

Sequence similaritiesi

Belongs to the mitochondrial Rho GTPase family.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1707 Eukaryota
ENOG410XRHW LUCA
GeneTreeiENSGT00390000014374
HOVERGENiHBG079778
InParanoidiQ8IXI2
KOiK07870
OMAiCSAKTLH
OrthoDBiEOG091G04UF
PhylomeDBiQ8IXI2
TreeFamiTF300814

Family and domain databases

InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR013566 EF_hand_assoc_1
IPR013567 EF_hand_assoc_2
IPR002048 EF_hand_dom
IPR021181 Miro
IPR020860 MIRO_dom
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF08355 EF_assoc_1, 1 hit
PF08356 EF_assoc_2, 1 hit
PF00071 Ras, 1 hit
PIRSFiPIRSF037488 Mt_Rho_GTPase, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
SSF52540 SSF52540, 2 hits
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS51423 MIRO, 2 hits

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IXI2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKKDVRILLV GEPRVGKTSL IMSLVSEEFP EEVPPRAEEI TIPADVTPER
60 70 80 90 100
VPTHIVDYSE AEQSDEQLHQ EISQANVICI VYAVNNKHSI DKVTSRWIPL
110 120 130 140 150
INERTDKDSR LPLILVGNKS DLVEYSSMET ILPIMNQYTE IETCVECSAK
160 170 180 190 200
NLKNISELFY YAQKAVLHPT GPLYCPEEKE MKPACIKALT RIFKISDQDN
210 220 230 240 250
DGTLNDAELN FFQRICFNTP LAPQALEDVK NVVRKHISDG VADSGLTLKG
260 270 280 290 300
FLFLHTLFIQ RGRHETTWTV LRRFGYDDDL DLTPEYLFPL LKIPPDCTTE
310 320 330 340 350
LNHHAYLFLQ STFDKHDLDR DCALSPDELK DLFKVFPYIP WGPDVNNTVC
360 370 380 390 400
TNERGWITYQ GFLSQWTLTT YLDVQRCLEY LGYLGYSILT EQESQASAVT
410 420 430 440 450
VTRDKKIDLQ KKQTQRNVFR CNVIGVKNCG KSGVLQALLG RNLMRQKKIR
460 470 480 490 500
EDHKSYYAIN TVYVYGQEKY LLLHDISESE FLTEAEIICD VVCLVYDVSN
510 520 530 540 550
PKSFEYCARI FKQHFMDSRI PCLIVAAKSD LHEVKQEYSI SPTDFCRKHK
560 570 580 590 600
MPPPQAFTCN TADAPSKDIF VKLTTMAMYP HVTQADLKSS TFWLRASFGA
610
TVFAVLGFAM YKALLKQR
Length:618
Mass (Da):70,784
Last modified:June 13, 2006 - v2
Checksum:iFE47AC3A4AF6F6C2
GO
Isoform 2 (identifier: Q8IXI2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAL

Show »
Length:650
Mass (Da):74,752
Checksum:i9E2A92E79F9160E1
GO
Isoform 3 (identifier: Q8IXI2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PEDHYRDRLSRDMGHTDRIENLRKIWVFLKTAFHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Show »
Length:691
Mass (Da):79,547
Checksum:i478FF7C2F8DD1986
GO
Isoform 4 (identifier: Q8IXI2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     581-618: Missing.

Note: No experimental confirmation available.
Show »
Length:580
Mass (Da):66,541
Checksum:iEC42DCCD95811BC3
GO
Isoform 5 (identifier: Q8IXI2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     582-618: VTQADLKSST...AMYKALLKQR → ARLRCMCTCN...TAVLNRIISA

Note: No experimental confirmation available.
Show »
Length:625
Mass (Da):71,687
Checksum:i3968C61EE9945024
GO
Isoform 6 (identifier: Q8IXI2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-247: QALEDVKNVVRKHISDGVADSGLT → RFGFEQVLVLLFLQFWALLCTKHY
     248-618: Missing.

Note: No experimental confirmation available.
Show »
Length:247
Mass (Da):28,265
Checksum:i3802160B22935376
GO
Isoform 7 (identifier: Q8IXI2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     580-580: P → PHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNR

Note: No experimental confirmation available.
Show »
Length:659
Mass (Da):75,546
Checksum:i82C8A91A753D656F
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BXZ6H7BXZ6_HUMAN
Mitochondrial Rho GTPase
RHOT1 hCG_1991479
597Annotation score:
J3QSG2J3QSG2_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
40Annotation score:
J3QLG2J3QLG2_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
134Annotation score:
K7EIQ7K7EIQ7_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
190Annotation score:
K7EP86K7EP86_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
156Annotation score:
J3KSR5J3KSR5_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
51Annotation score:
J3KRG7J3KRG7_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
57Annotation score:
A0A2R8Y4I2A0A2R8Y4I2_HUMAN
Mitochondrial Rho GTPase 1
RHOT1
48Annotation score:

Sequence cautioni

The sequence AAH41114 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH68463 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91969 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14185 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti75A → V in AAM15734 (Ref. 3) Curated1
Sequence conflicti246L → F in AAH60781 (PubMed:15489334).Curated1
Sequence conflicti246L → F in BAA91969 (PubMed:14702039).Curated1
Sequence conflicti331D → G in AAH60781 (PubMed:15489334).Curated1
Sequence conflicti587L → P in CAD56956 (PubMed:12482879).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019153224 – 247QALED…DSGLT → RFGFEQVLVLLFLQFWALLC TKHY in isoform 6. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_019154248 – 618Missing in isoform 6. 1 PublicationAdd BLAST371
Alternative sequenceiVSP_019155580P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAL in isoform 2. 2 Publications1
Alternative sequenceiVSP_019156580P → PEDHYRDRLSRDMGHTDRIE NLRKIWVFLKTAFHARLRCM CTCNRCTFCICQNFLNSDLL QSVKNKIFTAVLNR in isoform 3. 3 Publications1
Alternative sequenceiVSP_047651580P → PHARLRCMCTCNRCTFCICQ NFLNSDLLQSVKNKIFTAVL NR in isoform 7. Curated1
Alternative sequenceiVSP_019157581 – 618Missing in isoform 4. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_019158582 – 618VTQAD…LLKQR → ARLRCMCTCNRCTFCICQNF LNSDLLQSVKNKIFTAVLNR IISA in isoform 5. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496730 mRNA Translation: CAD43139.1
AJ517412 mRNA Translation: CAD56956.1
AY094972 mRNA Translation: AAM15734.1
AL136929 mRNA Translation: CAB66863.1
AK001902 mRNA Translation: BAA91969.1 Different initiation.
AK022695 mRNA Translation: BAB14185.1 Different initiation.
AK294407 mRNA Translation: BAG57659.1
AC116407 Genomic DNA No translation available.
AC026620 Genomic DNA No translation available.
BC015698 mRNA Translation: AAH15698.1
BC041114 mRNA Translation: AAH41114.1 Different initiation.
BC051818 mRNA Translation: AAH51818.1
BC060781 mRNA Translation: AAH60781.2
BC068463 mRNA Translation: AAH68463.1 Different initiation.
BC125104 mRNA Translation: AAI25105.1
BC125105 mRNA Translation: AAI25106.1
CCDSiCCDS32610.1 [Q8IXI2-3]
CCDS32611.1 [Q8IXI2-7]
CCDS32612.1 [Q8IXI2-1]
CCDS74030.1 [Q8IXI2-2]
RefSeqiNP_001028738.1, NM_001033566.2 [Q8IXI2-7]
NP_001028739.2, NM_001033567.2
NP_001028740.1, NM_001033568.2 [Q8IXI2-3]
NP_001275683.1, NM_001288754.1 [Q8IXI2-2]
NP_001275684.1, NM_001288755.1
NP_001275687.1, NM_001288758.1
NP_060777.3, NM_018307.4 [Q8IXI2-1]
UniGeneiHs.655325

Genome annotation databases

EnsembliENST00000333942; ENSP00000334724; ENSG00000126858 [Q8IXI2-1]
ENST00000358365; ENSP00000351132; ENSG00000126858 [Q8IXI2-3]
ENST00000394692; ENSP00000378184; ENSG00000126858 [Q8IXI2-2]
ENST00000545287; ENSP00000439737; ENSG00000126858 [Q8IXI2-7]
ENST00000581031; ENSP00000464094; ENSG00000126858 [Q8IXI2-5]
ENST00000581094; ENSP00000462669; ENSG00000126858 [Q8IXI2-4]
GeneIDi55288
KEGGihsa:55288
UCSCiuc002hgv.4 human [Q8IXI2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ496730 mRNA Translation: CAD43139.1
AJ517412 mRNA Translation: CAD56956.1
AY094972 mRNA Translation: AAM15734.1
AL136929 mRNA Translation: CAB66863.1
AK001902 mRNA Translation: BAA91969.1 Different initiation.
AK022695 mRNA Translation: BAB14185.1 Different initiation.
AK294407 mRNA Translation: BAG57659.1
AC116407 Genomic DNA No translation available.
AC026620 Genomic DNA No translation available.
BC015698 mRNA Translation: AAH15698.1
BC041114 mRNA Translation: AAH41114.1 Different initiation.
BC051818 mRNA Translation: AAH51818.1
BC060781 mRNA Translation: AAH60781.2
BC068463 mRNA Translation: AAH68463.1 Different initiation.
BC125104 mRNA Translation: AAI25105.1
BC125105 mRNA Translation: AAI25106.1
CCDSiCCDS32610.1 [Q8IXI2-3]
CCDS32611.1 [Q8IXI2-7]
CCDS32612.1 [Q8IXI2-1]
CCDS74030.1 [Q8IXI2-2]
RefSeqiNP_001028738.1, NM_001033566.2 [Q8IXI2-7]
NP_001028739.2, NM_001033567.2
NP_001028740.1, NM_001033568.2 [Q8IXI2-3]
NP_001275683.1, NM_001288754.1 [Q8IXI2-2]
NP_001275684.1, NM_001288755.1
NP_001275687.1, NM_001288758.1
NP_060777.3, NM_018307.4 [Q8IXI2-1]
UniGeneiHs.655325

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5KSOX-ray2.25A411-592[»]
5KSPX-ray2.16A/B411-592[»]
5KSYX-ray2.48A411-592[»]
5KSZX-ray2.50A177-592[»]
5KTYX-ray2.52A177-592[»]
5KU1X-ray2.50A177-592[»]
ProteinModelPortaliQ8IXI2
SMRiQ8IXI2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120576, 18 interactors
DIPiDIP-39114N
IntActiQ8IXI2, 19 interactors
MINTiQ8IXI2
STRINGi9606.ENSP00000351132

PTM databases

iPTMnetiQ8IXI2
PhosphoSitePlusiQ8IXI2

Polymorphism and mutation databases

DMDMi108860796

Proteomic databases

EPDiQ8IXI2
MaxQBiQ8IXI2
PaxDbiQ8IXI2
PeptideAtlasiQ8IXI2
PRIDEiQ8IXI2
ProteomicsDBi71002
71003 [Q8IXI2-2]
71004 [Q8IXI2-3]
71005 [Q8IXI2-4]
71006 [Q8IXI2-5]
71007 [Q8IXI2-6]

Protocols and materials databases

DNASUi55288
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000333942; ENSP00000334724; ENSG00000126858 [Q8IXI2-1]
ENST00000358365; ENSP00000351132; ENSG00000126858 [Q8IXI2-3]
ENST00000394692; ENSP00000378184; ENSG00000126858 [Q8IXI2-2]
ENST00000545287; ENSP00000439737; ENSG00000126858 [Q8IXI2-7]
ENST00000581031; ENSP00000464094; ENSG00000126858 [Q8IXI2-5]
ENST00000581094; ENSP00000462669; ENSG00000126858 [Q8IXI2-4]
GeneIDi55288
KEGGihsa:55288
UCSCiuc002hgv.4 human [Q8IXI2-1]

Organism-specific databases

CTDi55288
DisGeNETi55288
EuPathDBiHostDB:ENSG00000126858.16
GeneCardsiRHOT1
HGNCiHGNC:21168 RHOT1
HPAiCAB068223
CAB068224
HPA010687
MIMi613888 gene
neXtProtiNX_Q8IXI2
OpenTargetsiENSG00000126858
PharmGKBiPA134906318
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1707 Eukaryota
ENOG410XRHW LUCA
GeneTreeiENSGT00390000014374
HOVERGENiHBG079778
InParanoidiQ8IXI2
KOiK07870
OMAiCSAKTLH
OrthoDBiEOG091G04UF
PhylomeDBiQ8IXI2
TreeFamiTF300814

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
R-HSA-5689880 Ub-specific processing proteases

Miscellaneous databases

ChiTaRSiRHOT1 human
GeneWikiiRHOT1
GenomeRNAii55288
PROiPR:Q8IXI2
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000126858 Expressed in 235 organ(s), highest expression level in substantia nigra
CleanExiHS_RHOT1
ExpressionAtlasiQ8IXI2 baseline and differential
GenevisibleiQ8IXI2 HS

Family and domain databases

InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR013566 EF_hand_assoc_1
IPR013567 EF_hand_assoc_2
IPR002048 EF_hand_dom
IPR021181 Miro
IPR020860 MIRO_dom
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF08355 EF_assoc_1, 1 hit
PF08356 EF_assoc_2, 1 hit
PF00071 Ras, 1 hit
PIRSFiPIRSF037488 Mt_Rho_GTPase, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
SSF52540 SSF52540, 2 hits
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 1 hit
PS50222 EF_HAND_2, 2 hits
PS51423 MIRO, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiMIRO1_HUMAN
AccessioniPrimary (citable) accession number: Q8IXI2
Secondary accession number(s): A4FVB6
, A6NFV0, B4DG48, J9JIH9, Q6NUR3, Q6P9F8, Q6PJG1, Q6YMW8, Q86UB0, Q8IW28, Q8IXJ7, Q9H067, Q9H9N8, Q9NUZ2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: November 7, 2018
This is version 153 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again