Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spindle and kinetochore-associated protein 3

Gene

SKA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:19289083, PubMed:19360002, PubMed:23085020). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083, PubMed:19360002). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:19289083). In the complex, it mediates the microtubule-stimulated oligomerization (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020).3 Publications

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • chromosome segregation Source: UniProtKB
  • mitotic cell cycle Source: UniProtKB
  • regulation of microtubule polymerization or depolymerization Source: UniProtKB

Keywordsi

Biological processCell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Spindle and kinetochore-associated protein 3
Gene namesi
Name:SKA3
Synonyms:C13orf3, RAMA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000165480.15
HGNCiHGNC:20262 SKA3
neXtProtiNX_Q8IX90

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi221150
OpenTargetsiENSG00000165480
PharmGKBiPA165505498

Polymorphism and mutation databases

BioMutaiSKA3
DMDMi73620123

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000898781 – 412Spindle and kinetochore-associated protein 3Add BLAST412

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei34PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1
Modified residuei139PhosphoserineCombined sources1
Modified residuei152PhosphoserineCombined sources1
Modified residuei155PhosphoserineCombined sources1
Modified residuei159PhosphoserineCombined sources1
Modified residuei265PhosphothreonineCombined sources1
Modified residuei267PhosphoserineCombined sources1
Modified residuei318PhosphoserineCombined sources1
Modified residuei384PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8IX90
MaxQBiQ8IX90
PaxDbiQ8IX90
PeptideAtlasiQ8IX90
PRIDEiQ8IX90
ProteomicsDBi70973
70974 [Q8IX90-2]
70975 [Q8IX90-3]

PTM databases

iPTMnetiQ8IX90
PhosphoSitePlusiQ8IX90

Expressioni

Gene expression databases

BgeeiENSG00000165480 Expressed in 92 organ(s), highest expression level in secondary oocyte
CleanExiHS_C13orf3
ExpressionAtlasiQ8IX90 baseline and differential
GenevisibleiQ8IX90 HS

Organism-specific databases

HPAiHPA039272

Interactioni

Subunit structurei

Component of the SKA1 complex, composed of SKA1, SKA2 and SKA3 (PubMed:19289083, PubMed:19360002). The core SKA1 complex is composed of 2 SKA1-SKA2 heterodimers, each heterodimer interacting with a molecule of the SKA3 homodimer (PubMed:19289083, PubMed:19360002). The core SKA1 complex associates with microtubules and forms oligomeric assemblies (PubMed:19289083, PubMed:19360002, PubMed:23085020). Interacts with SKA1; the interaction is direct (PubMed:19289083, PubMed:23085020).3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SKA1Q96BD88EBI-1773976,EBI-741854

Protein-protein interaction databases

BioGridi128691, 88 interactors
IntActiQ8IX90, 31 interactors
MINTiQ8IX90
STRINGi9606.ENSP00000319417

Structurei

Secondary structure

1412
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8IX90
SMRiQ8IX90
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SKA3 family.Curated

Phylogenomic databases

eggNOGiENOG410IM6Y Eukaryota
ENOG4111P70 LUCA
GeneTreeiENSGT00500000045005
InParanoidiQ8IX90
OMAiLMKKNSM
OrthoDBiEOG091G03IY
PhylomeDBiQ8IX90
TreeFamiTF332721

Family and domain databases

InterProiView protein in InterPro
IPR033341 SKA3
PANTHERiPTHR28543 PTHR28543, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IX90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDPIRSFCGK LRSLASTLDC ETARLQRALD GEESDFEDYP MRILYDLHSE
60 70 80 90 100
VQTLKDDVNI LLDKARLENQ EGIDFIKATK VLMEKNSMDI MKIREYFQKY
110 120 130 140 150
GYSPRVKKNS VHEQEAINSD PELSNCENFQ KTDVKDDLSD PPVASSCISE
160 170 180 190 200
KSPRSPQLSD FGLERYIVSQ VLPNPPQAVN NYKEEPVIVT PPTKQSLVKV
210 220 230 240 250
LKTPKCALKM DDFECVTPKL EHFGISEYTM CLNEDYTMGL KNARNNKSEE
260 270 280 290 300
AIDTESRLND NVFATPSPII QQLEKSDAEY TNSPLVPTFC TPGLKIPSTK
310 320 330 340 350
NSIALVSTNY PLSKTNSSSN DLEVEDRTSL VLNSDTCFEN LTDPSSPTIS
360 370 380 390 400
SYENLLRTPT PPEVTKIPED ILQLLSKYNS NLATPIAIKA VPPSKRFLKH
410
GQNIRDVSNK EN
Length:412
Mass (Da):46,359
Last modified:August 16, 2005 - v2
Checksum:iBCC48E527DD8AA84
GO
Isoform 2 (identifier: Q8IX90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-35: D → G
     36-412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:35
Mass (Da):3,827
Checksum:iA3043098EB66C14B
GO
Isoform 3 (identifier: Q8IX90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-412: LLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN → KFQWIYPTQKLNKMR

Show »
Length:388
Mass (Da):43,978
Checksum:iF7E81B976A9D04EF
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H8H7F5H8H7_HUMAN
Spindle and kinetochore-associated ...
SKA3
49Annotation score:
F5GWG1F5GWG1_HUMAN
Spindle and kinetochore-associated ...
SKA3
36Annotation score:

Sequence cautioni

The sequence AAH13418 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated
The sequence BAG37379 differs from that shown. Reason: Frameshift at position 29.Curated
The sequence BAG37379 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence EAX08294 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05783158V → I1 PublicationCorresponds to variant dbSNP:rs11546983Ensembl.1
Natural variantiVAR_023113254T → A1 PublicationCorresponds to variant dbSNP:rs17345690Ensembl.1
Natural variantiVAR_057832335D → E1 PublicationCorresponds to variant dbSNP:rs17279819Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04052735D → G in isoform 2. 1 Publication1
Alternative sequenceiVSP_04052836 – 412Missing in isoform 2. 1 PublicationAdd BLAST377
Alternative sequenceiVSP_037245374 – 412LLSKY…SNKEN → KFQWIYPTQKLNKMR in isoform 3. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF361358 mRNA Translation: AAO13796.1
AK090584 mRNA Translation: BAC03484.1
AK314864 mRNA Translation: BAG37379.1 Sequence problems.
AL158032 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08293.1
CH471075 Genomic DNA Translation: EAX08294.1 Sequence problems.
CH471075 Genomic DNA Translation: EAX08295.1
BC013418 mRNA Translation: AAH13418.1 Sequence problems.
BC048988 mRNA Translation: AAH48988.1
CCDSiCCDS31946.1 [Q8IX90-1]
CCDS53856.1 [Q8IX90-3]
RefSeqiNP_001159489.1, NM_001166017.1 [Q8IX90-3]
NP_659498.4, NM_145061.5 [Q8IX90-1]
XP_005266345.1, XM_005266288.3
UniGeneiHs.88523

Genome annotation databases

EnsembliENST00000298260; ENSP00000298260; ENSG00000165480 [Q8IX90-2]
ENST00000314759; ENSP00000319417; ENSG00000165480 [Q8IX90-1]
ENST00000400018; ENSP00000382896; ENSG00000165480 [Q8IX90-3]
GeneIDi221150
KEGGihsa:221150
UCSCiuc001unt.3 human [Q8IX90-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF361358 mRNA Translation: AAO13796.1
AK090584 mRNA Translation: BAC03484.1
AK314864 mRNA Translation: BAG37379.1 Sequence problems.
AL158032 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08293.1
CH471075 Genomic DNA Translation: EAX08294.1 Sequence problems.
CH471075 Genomic DNA Translation: EAX08295.1
BC013418 mRNA Translation: AAH13418.1 Sequence problems.
BC048988 mRNA Translation: AAH48988.1
CCDSiCCDS31946.1 [Q8IX90-1]
CCDS53856.1 [Q8IX90-3]
RefSeqiNP_001159489.1, NM_001166017.1 [Q8IX90-3]
NP_659498.4, NM_145061.5 [Q8IX90-1]
XP_005266345.1, XM_005266288.3
UniGeneiHs.88523

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4AJ5X-ray3.321/2/3/4/U/V/W/X/Y/Z1-101[»]
ProteinModelPortaliQ8IX90
SMRiQ8IX90
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128691, 88 interactors
IntActiQ8IX90, 31 interactors
MINTiQ8IX90
STRINGi9606.ENSP00000319417

PTM databases

iPTMnetiQ8IX90
PhosphoSitePlusiQ8IX90

Polymorphism and mutation databases

BioMutaiSKA3
DMDMi73620123

Proteomic databases

EPDiQ8IX90
MaxQBiQ8IX90
PaxDbiQ8IX90
PeptideAtlasiQ8IX90
PRIDEiQ8IX90
ProteomicsDBi70973
70974 [Q8IX90-2]
70975 [Q8IX90-3]

Protocols and materials databases

DNASUi221150
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298260; ENSP00000298260; ENSG00000165480 [Q8IX90-2]
ENST00000314759; ENSP00000319417; ENSG00000165480 [Q8IX90-1]
ENST00000400018; ENSP00000382896; ENSG00000165480 [Q8IX90-3]
GeneIDi221150
KEGGihsa:221150
UCSCiuc001unt.3 human [Q8IX90-1]

Organism-specific databases

CTDi221150
DisGeNETi221150
EuPathDBiHostDB:ENSG00000165480.15
GeneCardsiSKA3
H-InvDBiHIX0011164
HGNCiHGNC:20262 SKA3
HPAiHPA039272
neXtProtiNX_Q8IX90
OpenTargetsiENSG00000165480
PharmGKBiPA165505498
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IM6Y Eukaryota
ENOG4111P70 LUCA
GeneTreeiENSGT00500000045005
InParanoidiQ8IX90
OMAiLMKKNSM
OrthoDBiEOG091G03IY
PhylomeDBiQ8IX90
TreeFamiTF332721

Miscellaneous databases

ChiTaRSiSKA3 human
GenomeRNAii221150
PROiPR:Q8IX90

Gene expression databases

BgeeiENSG00000165480 Expressed in 92 organ(s), highest expression level in secondary oocyte
CleanExiHS_C13orf3
ExpressionAtlasiQ8IX90 baseline and differential
GenevisibleiQ8IX90 HS

Family and domain databases

InterProiView protein in InterPro
IPR033341 SKA3
PANTHERiPTHR28543 PTHR28543, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSKA3_HUMAN
AccessioniPrimary (citable) accession number: Q8IX90
Secondary accession number(s): A2A330
, A2A331, B2RBY2, Q5VZV5, Q86WR2, Q8NBG1, Q96D22
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: November 7, 2018
This is version 127 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again