Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable ATP-dependent RNA helicase DHX40

Gene

DHX40

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable ATP-dependent RNA helicase.By similarity

Catalytic activityi

ATP + H2O = ADP + phosphate.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi76 – 83ATPPROSITE-ProRule annotation8

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • ATP-dependent 3'-5' RNA helicase activity Source: GO_Central
  • RNA binding Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionHelicase, Hydrolase
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Probable ATP-dependent RNA helicase DHX40 (EC:3.6.4.13)
Alternative name(s):
DEAH box protein 40
Protein PAD
Gene namesi
Name:DHX40
Synonyms:DDX40
ORF Names:ARG147
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000108406.9
HGNCiHGNC:18018 DHX40
MIMi607570 gene
neXtProtiNX_Q8IX18

Pathology & Biotechi

Organism-specific databases

DisGeNETi79665
OpenTargetsiENSG00000108406
PharmGKBiPA27227

Polymorphism and mutation databases

BioMutaiDHX40
DMDMi116247771

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002523951 – 779Probable ATP-dependent RNA helicase DHX40Add BLAST779

Proteomic databases

EPDiQ8IX18
MaxQBiQ8IX18
PaxDbiQ8IX18
PeptideAtlasiQ8IX18
PRIDEiQ8IX18
ProteomicsDBi70964
70965 [Q8IX18-2]
70966 [Q8IX18-3]

PTM databases

iPTMnetiQ8IX18
PhosphoSitePlusiQ8IX18

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000108406 Expressed in 231 organ(s), highest expression level in pituitary gland
CleanExiHS_DHX40
ExpressionAtlasiQ8IX18 baseline and differential
GenevisibleiQ8IX18 HS

Organism-specific databases

HPAiHPA044350

Interactioni

Protein-protein interaction databases

BioGridi122790, 30 interactors
IntActiQ8IX18, 8 interactors
MINTiQ8IX18
STRINGi9606.ENSP00000251241

Structurei

3D structure databases

ProteinModelPortaliQ8IX18
SMRiQ8IX18
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini63 – 231Helicase ATP-bindingPROSITE-ProRule annotationAdd BLAST169
Domaini263 – 442Helicase C-terminalPROSITE-ProRule annotationAdd BLAST180

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi173 – 176DEAH box4

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0922 Eukaryota
COG1643 LUCA
GeneTreeiENSGT00910000144017
HOGENOMiHOG000175261
HOVERGENiHBG039428
InParanoidiQ8IX18
KOiK18711
OMAiVHDVIRF
OrthoDBiEOG091G0238
PhylomeDBiQ8IX18
TreeFamiTF332290

Family and domain databases

CDDicd00079 HELICc, 1 hit
InterProiView protein in InterPro
IPR011545 DEAD/DEAH_box_helicase_dom
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR011709 DUF1605
IPR007502 Helicase-assoc_dom
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00270 DEAD, 1 hit
PF04408 HA2, 1 hit
PF00271 Helicase_C, 1 hit
PF07717 OB_NTP_bind, 1 hit
SMARTiView protein in SMART
SM00487 DEXDc, 1 hit
SM00847 HA2, 1 hit
SM00490 HELICc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IX18-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRFPAVAGR APRRQEEGER SRDLQEERLS AVCIADREEK GCTSQEGGTT
60 70 80 90 100
PTFPIQKQRK KIIQAVRDNS FLIVTGNTGS GKTTQLPKYL YEAGFSQHGM
110 120 130 140 150
IGVTQPRKVA AISVAQRVAE EMKCTLGSKV GYQVRFDDCS SKETAIKYMT
160 170 180 190 200
DGCLLKHILG DPNLTKFSVI ILDEAHERTL TTDILFGLLK KLFQEKSPNR
210 220 230 240 250
KEHLKVVVMS ATMELAKLSA FFGNCPIFDI PGRLYPVREK FCNLIGPRDR
260 270 280 290 300
ENTAYIQAIV KVTMDIHLNE MAGDILVFLT GQFEIEKSCE LLFQMAESVD
310 320 330 340 350
YDYDVQDTTL DGLLILPCYG SMTTDQQRRI FLPPPPGIRK CVISTNISAT
360 370 380 390 400
SLTIDGIRYV VDGGFVKQLN HNPRLGLDIL EVVPISKSEA LQRSGRAGRT
410 420 430 440 450
SSGKCFRIYS KDFWNQCMPD HVIPEIKRTS LTSVVLTLKC LAIHDVIRFP
460 470 480 490 500
YLDPPNERLI LEALKQLYQC DAIDRSGHVT RLGLSMVEFP LPPHLTCAVI
510 520 530 540 550
KAASLDCEDL LLPIAAMLSV ENVFIRPVDP EYQKEAEQRH RELAAKAGGF
560 570 580 590 600
NDFATLAVIF EQCKSSGAPA SWCQKHWIHW RCLFSAFRVE AQLRELIRKL
610 620 630 640 650
KQQSDFPKET FEGPKHEVLR RCLCAGYFKN VARRSVGRTF CTMDGRGSPV
660 670 680 690 700
HIHPSSALHE QETKLEWIIF HEVLVTTKVY ARIVCPIRYE WVRDLLPKLH
710 720 730 740 750
EFNAHDLSSV ARREVREDAR RRWTNKENVK QLKDGISKDV LKKMQRRNDD
760 770
KSISDARARF LERKQQRTQD HSDTRKETG
Length:779
Mass (Da):88,560
Last modified:October 17, 2006 - v2
Checksum:iB49A996C51986827
GO
Isoform 2 (identifier: Q8IX18-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-99: Missing.
     326-326: Q → QQRRIFLPPPPGIRKCVISTNISATSLTIDGIRYVVDGGFVKQLNHNPRLGLE

Note: No experimental confirmation available.
Show »
Length:732
Mass (Da):83,320
Checksum:i9372AC4F43466126
GO
Isoform 3 (identifier: Q8IX18-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     716-722: REDARRR → MKIYYFQ
     723-779: Missing.

Note: No experimental confirmation available.
Show »
Length:722
Mass (Da):81,797
Checksum:i889558EDAAF6E5F6
GO
Isoform 4 (identifier: Q8IX18-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     66-142: Missing.

Note: Gene prediction based on EST data.
Show »
Length:702
Mass (Da):80,221
Checksum:iDE23745E99819ED8
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KTK0J3KTK0_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
173Annotation score:
J3KSW6J3KSW6_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
268Annotation score:
F5H625F5H625_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
250Annotation score:
J3KSX9J3KSX9_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
101Annotation score:
J3KS08J3KS08_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
71Annotation score:

Sequence cautioni

The sequence AAF70326 differs from that shown. Reason: Frameshift at position 758.Curated
The sequence AAK32122 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15226 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti261K → E in AAN77932 (PubMed:12522690).Curated1
Sequence conflicti449F → V in AAF70326 (Ref. 2) Curated1
Sequence conflicti643M → V in AAN77932 (PubMed:12522690).Curated1
Sequence conflicti672E → G in AAK32122 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0209321 – 99Missing in isoform 2. 1 PublicationAdd BLAST99
Alternative sequenceiVSP_04697366 – 142Missing in isoform 4. CuratedAdd BLAST77
Alternative sequenceiVSP_020933326Q → QQRRIFLPPPPGIRKCVIST NISATSLTIDGIRYVVDGGF VKQLNHNPRLGLE in isoform 2. 1 Publication1
Alternative sequenceiVSP_020934716 – 722REDARRR → MKIYYFQ in isoform 3. 1 Publication7
Alternative sequenceiVSP_020935723 – 779Missing in isoform 3. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461690 mRNA Translation: AAN77932.1
AF260270 mRNA Translation: AAF70326.1 Frameshift.
AK025713 mRNA Translation: BAB15226.1 Different initiation.
AK095681 mRNA Translation: BAG53107.1
AC004167 Genomic DNA No translation available.
AC091271 Genomic DNA No translation available.
BC024187 mRNA Translation: AAH24187.1
AL832510 mRNA Translation: CAI46197.1
AF319521 mRNA Translation: AAK32122.1 Different initiation.
CCDSiCCDS11617.1 [Q8IX18-1]
CCDS54150.1 [Q8IX18-4]
RefSeqiNP_001159773.1, NM_001166301.1 [Q8IX18-4]
NP_078888.4, NM_024612.4 [Q8IX18-1]
UniGeneiHs.29403

Genome annotation databases

EnsembliENST00000251241; ENSP00000251241; ENSG00000108406 [Q8IX18-1]
ENST00000425628; ENSP00000388749; ENSG00000108406 [Q8IX18-4]
GeneIDi79665
KEGGihsa:79665
UCSCiuc002ixn.3 human [Q8IX18-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461690 mRNA Translation: AAN77932.1
AF260270 mRNA Translation: AAF70326.1 Frameshift.
AK025713 mRNA Translation: BAB15226.1 Different initiation.
AK095681 mRNA Translation: BAG53107.1
AC004167 Genomic DNA No translation available.
AC091271 Genomic DNA No translation available.
BC024187 mRNA Translation: AAH24187.1
AL832510 mRNA Translation: CAI46197.1
AF319521 mRNA Translation: AAK32122.1 Different initiation.
CCDSiCCDS11617.1 [Q8IX18-1]
CCDS54150.1 [Q8IX18-4]
RefSeqiNP_001159773.1, NM_001166301.1 [Q8IX18-4]
NP_078888.4, NM_024612.4 [Q8IX18-1]
UniGeneiHs.29403

3D structure databases

ProteinModelPortaliQ8IX18
SMRiQ8IX18
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122790, 30 interactors
IntActiQ8IX18, 8 interactors
MINTiQ8IX18
STRINGi9606.ENSP00000251241

PTM databases

iPTMnetiQ8IX18
PhosphoSitePlusiQ8IX18

Polymorphism and mutation databases

BioMutaiDHX40
DMDMi116247771

Proteomic databases

EPDiQ8IX18
MaxQBiQ8IX18
PaxDbiQ8IX18
PeptideAtlasiQ8IX18
PRIDEiQ8IX18
ProteomicsDBi70964
70965 [Q8IX18-2]
70966 [Q8IX18-3]

Protocols and materials databases

DNASUi79665
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251241; ENSP00000251241; ENSG00000108406 [Q8IX18-1]
ENST00000425628; ENSP00000388749; ENSG00000108406 [Q8IX18-4]
GeneIDi79665
KEGGihsa:79665
UCSCiuc002ixn.3 human [Q8IX18-1]

Organism-specific databases

CTDi79665
DisGeNETi79665
EuPathDBiHostDB:ENSG00000108406.9
GeneCardsiDHX40
HGNCiHGNC:18018 DHX40
HPAiHPA044350
MIMi607570 gene
neXtProtiNX_Q8IX18
OpenTargetsiENSG00000108406
PharmGKBiPA27227
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0922 Eukaryota
COG1643 LUCA
GeneTreeiENSGT00910000144017
HOGENOMiHOG000175261
HOVERGENiHBG039428
InParanoidiQ8IX18
KOiK18711
OMAiVHDVIRF
OrthoDBiEOG091G0238
PhylomeDBiQ8IX18
TreeFamiTF332290

Miscellaneous databases

ChiTaRSiDHX40 human
GenomeRNAii79665
PROiPR:Q8IX18
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000108406 Expressed in 231 organ(s), highest expression level in pituitary gland
CleanExiHS_DHX40
ExpressionAtlasiQ8IX18 baseline and differential
GenevisibleiQ8IX18 HS

Family and domain databases

CDDicd00079 HELICc, 1 hit
InterProiView protein in InterPro
IPR011545 DEAD/DEAH_box_helicase_dom
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR011709 DUF1605
IPR007502 Helicase-assoc_dom
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00270 DEAD, 1 hit
PF04408 HA2, 1 hit
PF00271 Helicase_C, 1 hit
PF07717 OB_NTP_bind, 1 hit
SMARTiView protein in SMART
SM00487 DEXDc, 1 hit
SM00847 HA2, 1 hit
SM00490 HELICc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDHX40_HUMAN
AccessioniPrimary (citable) accession number: Q8IX18
Secondary accession number(s): B3KTJ5
, C9JR60, Q5JPH4, Q8TC86, Q8WY53, Q9BXM1, Q9H6M9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: November 7, 2018
This is version 140 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again