Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (26 Feb 2020)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Probable ATP-dependent RNA helicase DHX40

Gene

DHX40

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable ATP-dependent RNA helicase.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi76 – 83ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHelicase, Hydrolase
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable ATP-dependent RNA helicase DHX40 (EC:3.6.4.13)
Alternative name(s):
DEAH box protein 40
Protein PAD
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DHX40
Synonyms:DDX40
ORF Names:ARG147
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18018 DHX40

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607570 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IX18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79665

Open Targets

More...
OpenTargetsi
ENSG00000108406

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27227

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8IX18 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DHX40

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116247771

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002523951 – 779Probable ATP-dependent RNA helicase DHX40Add BLAST779

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IX18

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IX18

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8IX18

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IX18

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IX18

PeptideAtlas

More...
PeptideAtlasi
Q8IX18

PRoteomics IDEntifications database

More...
PRIDEi
Q8IX18

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
11330
70964 [Q8IX18-1]
70965 [Q8IX18-2]
70966 [Q8IX18-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IX18

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IX18

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000108406 Expressed in pituitary gland and 230 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IX18 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IX18 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA044350

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122790, 39 interactors

Protein interaction database and analysis system

More...
IntActi
Q8IX18, 15 interactors

Molecular INTeraction database

More...
MINTi
Q8IX18

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000251241

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8IX18 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IX18

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini63 – 231Helicase ATP-bindingPROSITE-ProRule annotationAdd BLAST169
Domaini263 – 442Helicase C-terminalPROSITE-ProRule annotationAdd BLAST180

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi173 – 176DEAH box4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0922 Eukaryota
COG1643 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158902

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001832_5_11_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IX18

KEGG Orthology (KO)

More...
KOi
K18711

Identification of Orthologs from Complete Genome Data

More...
OMAi
WIHWRAV

Database of Orthologous Groups

More...
OrthoDBi
354219at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IX18

TreeFam database of animal gene trees

More...
TreeFami
TF332290

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011545 DEAD/DEAH_box_helicase_dom
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR011709 DUF1605
IPR007502 Helicase-assoc_dom
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00270 DEAD, 1 hit
PF04408 HA2, 1 hit
PF00271 Helicase_C, 1 hit
PF07717 OB_NTP_bind, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00487 DEXDc, 1 hit
SM00847 HA2, 1 hit
SM00490 HELICc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IX18-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRFPAVAGR APRRQEEGER SRDLQEERLS AVCIADREEK GCTSQEGGTT
60 70 80 90 100
PTFPIQKQRK KIIQAVRDNS FLIVTGNTGS GKTTQLPKYL YEAGFSQHGM
110 120 130 140 150
IGVTQPRKVA AISVAQRVAE EMKCTLGSKV GYQVRFDDCS SKETAIKYMT
160 170 180 190 200
DGCLLKHILG DPNLTKFSVI ILDEAHERTL TTDILFGLLK KLFQEKSPNR
210 220 230 240 250
KEHLKVVVMS ATMELAKLSA FFGNCPIFDI PGRLYPVREK FCNLIGPRDR
260 270 280 290 300
ENTAYIQAIV KVTMDIHLNE MAGDILVFLT GQFEIEKSCE LLFQMAESVD
310 320 330 340 350
YDYDVQDTTL DGLLILPCYG SMTTDQQRRI FLPPPPGIRK CVISTNISAT
360 370 380 390 400
SLTIDGIRYV VDGGFVKQLN HNPRLGLDIL EVVPISKSEA LQRSGRAGRT
410 420 430 440 450
SSGKCFRIYS KDFWNQCMPD HVIPEIKRTS LTSVVLTLKC LAIHDVIRFP
460 470 480 490 500
YLDPPNERLI LEALKQLYQC DAIDRSGHVT RLGLSMVEFP LPPHLTCAVI
510 520 530 540 550
KAASLDCEDL LLPIAAMLSV ENVFIRPVDP EYQKEAEQRH RELAAKAGGF
560 570 580 590 600
NDFATLAVIF EQCKSSGAPA SWCQKHWIHW RCLFSAFRVE AQLRELIRKL
610 620 630 640 650
KQQSDFPKET FEGPKHEVLR RCLCAGYFKN VARRSVGRTF CTMDGRGSPV
660 670 680 690 700
HIHPSSALHE QETKLEWIIF HEVLVTTKVY ARIVCPIRYE WVRDLLPKLH
710 720 730 740 750
EFNAHDLSSV ARREVREDAR RRWTNKENVK QLKDGISKDV LKKMQRRNDD
760 770
KSISDARARF LERKQQRTQD HSDTRKETG
Length:779
Mass (Da):88,560
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB49A996C51986827
GO
Isoform 2 (identifier: Q8IX18-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-99: Missing.
     326-326: Q → QQRRIFLPPPPGIRKCVISTNISATSLTIDGIRYVVDGGFVKQLNHNPRLGLE

Show »
Length:732
Mass (Da):83,320
Checksum:i9372AC4F43466126
GO
Isoform 3 (identifier: Q8IX18-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     716-722: REDARRR → MKIYYFQ
     723-779: Missing.

Show »
Length:722
Mass (Da):81,797
Checksum:i889558EDAAF6E5F6
GO
Isoform 4 (identifier: Q8IX18-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     66-142: Missing.

Show »
Length:702
Mass (Da):80,221
Checksum:iDE23745E99819ED8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KTK0J3KTK0_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSW6J3KSW6_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
268Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSX9J3KSX9_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS08J3KS08_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H625F5H625_HUMAN
Probable ATP-dependent RNA helicase...
DHX40
250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF70326 differs from that shown. Reason: Frameshift.Curated
The sequence AAK32122 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15226 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti261K → E in AAN77932 (PubMed:12522690).Curated1
Sequence conflicti449F → V in AAF70326 (Ref. 2) Curated1
Sequence conflicti643M → V in AAN77932 (PubMed:12522690).Curated1
Sequence conflicti672E → G in AAK32122 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0209321 – 99Missing in isoform 2. 1 PublicationAdd BLAST99
Alternative sequenceiVSP_04697366 – 142Missing in isoform 4. CuratedAdd BLAST77
Alternative sequenceiVSP_020933326Q → QQRRIFLPPPPGIRKCVIST NISATSLTIDGIRYVVDGGF VKQLNHNPRLGLE in isoform 2. 1 Publication1
Alternative sequenceiVSP_020934716 – 722REDARRR → MKIYYFQ in isoform 3. 1 Publication7
Alternative sequenceiVSP_020935723 – 779Missing in isoform 3. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF461690 mRNA Translation: AAN77932.1
AF260270 mRNA Translation: AAF70326.1 Frameshift.
AK025713 mRNA Translation: BAB15226.1 Different initiation.
AK095681 mRNA Translation: BAG53107.1
AC004167 Genomic DNA No translation available.
AC091271 Genomic DNA No translation available.
BC024187 mRNA Translation: AAH24187.1
AL832510 mRNA Translation: CAI46197.1
AF319521 mRNA Translation: AAK32122.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11617.1 [Q8IX18-1]
CCDS54150.1 [Q8IX18-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001159773.1, NM_001166301.1 [Q8IX18-4]
NP_078888.4, NM_024612.4 [Q8IX18-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000251241; ENSP00000251241; ENSG00000108406 [Q8IX18-1]
ENST00000425628; ENSP00000388749; ENSG00000108406 [Q8IX18-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79665

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79665

UCSC genome browser

More...
UCSCi
uc002ixn.3 human [Q8IX18-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461690 mRNA Translation: AAN77932.1
AF260270 mRNA Translation: AAF70326.1 Frameshift.
AK025713 mRNA Translation: BAB15226.1 Different initiation.
AK095681 mRNA Translation: BAG53107.1
AC004167 Genomic DNA No translation available.
AC091271 Genomic DNA No translation available.
BC024187 mRNA Translation: AAH24187.1
AL832510 mRNA Translation: CAI46197.1
AF319521 mRNA Translation: AAK32122.1 Different initiation.
CCDSiCCDS11617.1 [Q8IX18-1]
CCDS54150.1 [Q8IX18-4]
RefSeqiNP_001159773.1, NM_001166301.1 [Q8IX18-4]
NP_078888.4, NM_024612.4 [Q8IX18-1]

3D structure databases

SMRiQ8IX18
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122790, 39 interactors
IntActiQ8IX18, 15 interactors
MINTiQ8IX18
STRINGi9606.ENSP00000251241

PTM databases

iPTMnetiQ8IX18
PhosphoSitePlusiQ8IX18

Polymorphism and mutation databases

BioMutaiDHX40
DMDMi116247771

Proteomic databases

EPDiQ8IX18
jPOSTiQ8IX18
MassIVEiQ8IX18
MaxQBiQ8IX18
PaxDbiQ8IX18
PeptideAtlasiQ8IX18
PRIDEiQ8IX18
ProteomicsDBi11330
70964 [Q8IX18-1]
70965 [Q8IX18-2]
70966 [Q8IX18-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
79665

Genome annotation databases

EnsembliENST00000251241; ENSP00000251241; ENSG00000108406 [Q8IX18-1]
ENST00000425628; ENSP00000388749; ENSG00000108406 [Q8IX18-4]
GeneIDi79665
KEGGihsa:79665
UCSCiuc002ixn.3 human [Q8IX18-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79665
DisGeNETi79665

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DHX40
HGNCiHGNC:18018 DHX40
HPAiHPA044350
MIMi607570 gene
neXtProtiNX_Q8IX18
OpenTargetsiENSG00000108406
PharmGKBiPA27227

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0922 Eukaryota
COG1643 LUCA
GeneTreeiENSGT00940000158902
HOGENOMiCLU_001832_5_11_1
InParanoidiQ8IX18
KOiK18711
OMAiWIHWRAV
OrthoDBi354219at2759
PhylomeDBiQ8IX18
TreeFamiTF332290

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DHX40 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79665
PharosiQ8IX18 Tdark

Protein Ontology

More...
PROi
PR:Q8IX18
RNActiQ8IX18 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000108406 Expressed in pituitary gland and 230 other tissues
ExpressionAtlasiQ8IX18 baseline and differential
GenevisibleiQ8IX18 HS

Family and domain databases

InterProiView protein in InterPro
IPR011545 DEAD/DEAH_box_helicase_dom
IPR002464 DNA/RNA_helicase_DEAH_CS
IPR011709 DUF1605
IPR007502 Helicase-assoc_dom
IPR014001 Helicase_ATP-bd
IPR001650 Helicase_C
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00270 DEAD, 1 hit
PF04408 HA2, 1 hit
PF00271 Helicase_C, 1 hit
PF07717 OB_NTP_bind, 1 hit
SMARTiView protein in SMART
SM00487 DEXDc, 1 hit
SM00847 HA2, 1 hit
SM00490 HELICc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00690 DEAH_ATP_HELICASE, 1 hit
PS51192 HELICASE_ATP_BIND_1, 1 hit
PS51194 HELICASE_CTER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDHX40_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IX18
Secondary accession number(s): B3KTJ5
, C9JR60, Q5JPH4, Q8TC86, Q8WY53, Q9BXM1, Q9H6M9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: February 26, 2020
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again