Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (10 Apr 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ankyrin repeat and KH domain-containing protein 1

Gene

ANKHD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role as a scaffolding protein that may be associated with the abnormal phenotype of leukemia cells. Isoform 2 may possess an antiapoptotic effect and protect cells during normal cell survival through its regulation of caspases.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • innate immune response Source: GO_Central

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat and KH domain-containing protein 1
Alternative name(s):
HIV-1 Vpr-binding ankyrin repeat protein
Multiple ankyrin repeats single KH domain
Short name:
hMASK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANKHD1
Synonyms:KIAA1085, MASK, VBARP
ORF Names:PP2500
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000131503.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24714 ANKHD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610500 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IWZ3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
404734
54882

Open Targets

More...
OpenTargetsi
ENSG00000131503

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134947858
PA162376432

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANKHD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74750718

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003063261 – 2542Ankyrin repeat and KH domain-containing protein 1Add BLAST2542

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei101PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei803PhosphoserineCombined sources1
Modified residuei1540PhosphoserineCombined sources1
Modified residuei1553PhosphothreonineCombined sources1
Modified residuei1632PhosphoserineCombined sources1
Modified residuei1653PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IWZ3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IWZ3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IWZ3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IWZ3

PeptideAtlas

More...
PeptideAtlasi
Q8IWZ3

PRoteomics IDEntifications database

More...
PRIDEi
Q8IWZ3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70935
70936 [Q8IWZ3-2]
70937 [Q8IWZ3-3]
70938 [Q8IWZ3-4]
70939 [Q8IWZ3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IWZ3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IWZ3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8IWZ3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous with high expression in cervix, spleen and brain. Expressed in hematopoietic cells with increased expression in leukemia cells. Isoform 2 is highly expressed in spleen with almost no expression in muscle and brain.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000131503 Expressed in 207 organ(s), highest expression level in small intestine Peyer's patch

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IWZ3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IWZ3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA008718

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PTPN11. Isoform 2 interacts with HIV-1 VPR. Interacts with NOD2 (PubMed:27812135).3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120230, 62 interactors
135698, 34 interactors

Database of interacting proteins

More...
DIPi
DIP-36371N

Protein interaction database and analysis system

More...
IntActi
Q8IWZ3, 30 interactors

Molecular INTeraction database

More...
MINTi
Q8IWZ3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000354085

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8IWZ3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IWZ3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati204 – 233ANK 1Add BLAST30
Repeati237 – 266ANK 2Add BLAST30
Repeati271 – 300ANK 3Add BLAST30
Repeati304 – 333ANK 4Add BLAST30
Repeati337 – 366ANK 5Add BLAST30
Repeati371 – 400ANK 6Add BLAST30
Repeati404 – 433ANK 7Add BLAST30
Repeati437 – 466ANK 8Add BLAST30
Repeati470 – 499ANK 9Add BLAST30
Repeati504 – 533ANK 10Add BLAST30
Repeati534 – 563ANK 11Add BLAST30
Repeati567 – 596ANK 12Add BLAST30
Repeati600 – 629ANK 13Add BLAST30
Repeati634 – 663ANK 14Add BLAST30
Repeati667 – 696ANK 15Add BLAST30
Repeati1054 – 1083ANK 16Add BLAST30
Repeati1087 – 1116ANK 17Add BLAST30
Repeati1121 – 1150ANK 18Add BLAST30
Repeati1154 – 1183ANK 19Add BLAST30
Repeati1189 – 1218ANK 20Add BLAST30
Repeati1223 – 1252ANK 21Add BLAST30
Repeati1256 – 1285ANK 22Add BLAST30
Repeati1291 – 1320ANK 23Add BLAST30
Repeati1324 – 1353ANK 24Add BLAST30
Repeati1357 – 1386ANK 25Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1695 – 1759KHPROSITE-ProRule annotationAdd BLAST65

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili775 – 852Sequence analysisAdd BLAST78
Coiled coili1415 – 1485Sequence analysisAdd BLAST71

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi6 – 94Gly-richAdd BLAST89
Compositional biasi1977 – 2100Ser-richAdd BLAST124
Compositional biasi2291 – 2299Poly-Ser9

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the mask family.Curated

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0504 Eukaryota
KOG4369 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153768

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000033942

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG071352

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IWZ3

KEGG Orthology (KO)

More...
KOi
K16726

Identification of Orthologs from Complete Genome Data

More...
OMAi
IIGQPQI

Database of Orthologous Groups

More...
OrthoDBi
1115202at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IWZ3

TreeFam database of animal gene trees

More...
TreeFami
TF328552

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 7 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 8 hits
3.30.1370.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 9 hits
PF00013 KH_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 25 hits
SM00322 KH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 3 hits
SSF54791 SSF54791, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 20 hits
PS50084 KH_TYPE_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IWZ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLTDSGGGGT SFEEDLDSVA PRSAPAGASE PPPPGGVGLG IRTVRLFGEA
60 70 80 90 100
GPASGVGSSG GGGSGSGTGG GDAALDFKLA AAVLRTGGGG GASGSDEDEV
110 120 130 140 150
SEVESFILDQ EDLDNPVLKT TSEIFLSSTA EGADLRTVDP ETQARLEALL
160 170 180 190 200
EAAGIGKLST ADGKAFADPE VLRRLTSSVS CALDEAAAAL TRMKAENSHN
210 220 230 240 250
AGQVDTRSLA EACSDGDVNA VRKLLDEGRS VNEHTEEGES LLCLACSAGY
260 270 280 290 300
YELAQVLLAM HANVEDRGNK GDITPLMAAS SGGYLDIVKL LLLHDADVNS
310 320 330 340 350
QSATGNTALT YACAGGFVDI VKVLLNEGAN IEDHNENGHT PLMEAASAGH
360 370 380 390 400
VEVARVLLDH GAGINTHSNE FKESALTLAC YKGHLDMVRF LLEAGADQEH
410 420 430 440 450
KTDEMHTALM EACMDGHVEV ARLLLDSGAQ VNMPADSFES PLTLAACGGH
460 470 480 490 500
VELAALLIER GANLEEVNDE GYTPLMEAAR EGHEEMVALL LAQGANINAQ
510 520 530 540 550
TEETQETALT LACCGGFSEV ADFLIKAGAD IELGCSTPLM EASQEGHLEL
560 570 580 590 600
VKYLLASGAN VHATTATGDT ALTYACENGH TDVADVLLQA GADLEHESEG
610 620 630 640 650
GRTPLMKAAR AGHLCTVQFL ISKGANVNRA TANNDHTVVS LACAGGHLAV
660 670 680 690 700
VELLLAHGAD PTHRLKDGST MLIEAAKGGH TNVVSYLLDY PNNVLSVPTT
710 720 730 740 750
DVSQLPPPSQ DQSQVPRVPT HTLAMVVPPQ EPDRTSQENS PALLGVQKGT
760 770 780 790 800
SKQKSSSLQV ADQDLLPSFH PYQPLECIVE ETEGKLNELG QRISAIEKAQ
810 820 830 840 850
LKSLELIQGE PLNKDKIEEL KKNREEQVQK KKKILKELQK VERQLQMKTQ
860 870 880 890 900
QQFTKEYLET KGQKDTVSLH QQCSHRGVFP EGEGDGSLPE DHFSELPQVD
910 920 930 940 950
TILFKDNDVD DEQQSPPSAE QIDFVPVQPL SSPQCNFSSD LGSNGTNSLE
960 970 980 990 1000
LQKVSGNQQI VGQPQIAITG HDQGLLVQEP DGLMVATPAQ TLTDTLDDLI
1010 1020 1030 1040 1050
AAVSTRVPTG SNSSSQTTEC LTPESCSQTT SNVASQSMPP VYPSVDIDAH
1060 1070 1080 1090 1100
TESNHDTALT LACAGGHEEL VSVLIARDAK IEHRDKKGFT PLILAATAGH
1110 1120 1130 1140 1150
VGVVEILLDK GGDIEAQSER TKDTPLSLAC SGGRQEVVDL LLARGANKEH
1160 1170 1180 1190 1200
RNVSDYTPLS LAASGGYVNI IKILLNAGAE INSRTGSKLG ISPLMLAAMN
1210 1220 1230 1240 1250
GHVPAVKLLL DMGSDINAQI ETNRNTALTL ACFQGRAEVV SLLLDRKANV
1260 1270 1280 1290 1300
EHRAKTGLTP LMEAASGGYA EVGRVLLDKG ADVNAPPVPS SRDTALTIAA
1310 1320 1330 1340 1350
DKGHYKFCEL LIHRGAHIDV RNKKGNTPLW LASNGGHFDV VQLLVQAGAD
1360 1370 1380 1390 1400
VDAADNRKIT PLMSAFRKGH VKVVQYLVKE VNQFPSDIEC MRYIATITDK
1410 1420 1430 1440 1450
ELLKKCHQCV ETIVKAKDQQ AAEANKNASI LLKELDLEKS REESRKQALA
1460 1470 1480 1490 1500
AKREKRKEKR KKKKEEQKRK QEEDEENKPK ENSELPEDED EEENDEDVEQ
1510 1520 1530 1540 1550
EVPIEPPSAT TTTTIGISAT SATFTNVFGK KRANVVTTPS TNRKNKKNKT
1560 1570 1580 1590 1600
KETPPTAHLI LPEQHMSLAQ QKADKNKING EPRGGGAGGN SDSDNLDSTD
1610 1620 1630 1640 1650
CNSESSSGGK SQELNFVMDV NSSKYPSLLL HSQEEKTSTA TSKTQTRLEG
1660 1670 1680 1690 1700
EVTPNSLSTS YKTVSLPLSS PNIKLNLTSP KRGQKREEGW KEVVRRSKKL
1710 1720 1730 1740 1750
SVPASVVSRI MGRGGCNITA IQDVTGAHID VDKQKDKNGE RMITIRGGTE
1760 1770 1780 1790 1800
STRYAVQLIN ALIQDPAKEL EDLIPKNHIR TPASTKSIHA NFSSGVGTTA
1810 1820 1830 1840 1850
ASSKNAFPLG APTLVTSQAT TLSTFQPANK LNKNVPTNVR SSFPVSLPLA
1860 1870 1880 1890 1900
YPHPHFALLA AQTMQQIRHP RLPMAQFGGT FSPSPNTWGP FPVRPVNPGN
1910 1920 1930 1940 1950
TNSSPKHNNT SRLPNQNGTV LPSESAGLAT ASCPITVSSV VAASQQLCVT
1960 1970 1980 1990 2000
NTRTPSSVRK QLFACVPKTS PPATVISSVT STCSSLPSVS SAPITSGQAP
2010 2020 2030 2040 2050
TTFLPASTSQ AQLSSQKMES FSAVPPTKEK VSTQDQPMAN LCTPSSTANS
2060 2070 2080 2090 2100
CSSSASNTPG APETHPSSSP TPTSSNTQEE AQPSSVSDLS PMSMPFASNS
2110 2120 2130 2140 2150
EPAPLTLTSP RMVAADNQDT SNLPQLAVPA PRVSHRMQPR GSFYSMVPNA
2160 2170 2180 2190 2200
TIHQDPQSIF VTNPVTLTPP QGPPAAVQLS SAVNIMNGSQ MHINPANKSL
2210 2220 2230 2240 2250
PPTFGPATLF NHFSSLFDSS QVPANQGWGD GPLSSRVATD ASFTVQSAFL
2260 2270 2280 2290 2300
GNSVLGHLEN MHPDNSKAPG FRPPSQRVST SPVGLPSIDP SGSSPSSSSA
2310 2320 2330 2340 2350
PLASFSGIPG TRVFLQGPAP VGTPSFNRQH FSPHPWTSAS NSSTSAPPTL
2360 2370 2380 2390 2400
GQPKGVSASQ DRKIPPPIGT ERLARIRQGG SVAQAPAGTS FVAPVGHSGI
2410 2420 2430 2440 2450
WSFGVNAVSE GLSGWSQSVM GNHPMHQQLS DPSTFSQHQP MERDDSGMVA
2460 2470 2480 2490 2500
PSNIFHQPMA SGFVDFSKGL PISMYGGTII PSHPQLADVP GGPLFNGLHN
2510 2520 2530 2540
PDPAWNPMIK VIQNSTECTD AQQIWPGTWA PHIGNMHLKY VN
Length:2,542
Mass (Da):269,458
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAB310E826A4134D0
GO
Isoform 2 (identifier: Q8IWZ3-2) [UniParc]FASTAAdd to basket
Also known as: VBARP-L

The sequence of this isoform differs from the canonical sequence as follows:
     595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE
     628-2542: Missing.

Show »
Length:627
Mass (Da):64,912
Checksum:i141288C8EC9A42CB
GO
Isoform 3 (identifier: Q8IWZ3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-164: Missing.
     595-627: EHESEGGRTPLMKAARAGHLCTVQFLISKGANV → DKQEDMKTILEGIDPAKHQVRVAFDACKLLRKE
     628-2542: Missing.

Show »
Length:616
Mass (Da):63,884
Checksum:i813BEFD05BB8753B
GO
Isoform 4 (identifier: Q8IWZ3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2342-2343: SS → SCDSPIPSVSSGSSSPLSA
     2524-2542: IWPGTWAPHIGNMHLKYVN → VKWA

Show »
Length:2,544
Mass (Da):269,298
Checksum:iCF2D5BAF8FF3D40D
GO
Isoform 5 (identifier: Q8IWZ3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     559-581: ANVHATTATGDTALTYACENGHT → QAGGHEDYFGGHRSGQASGEGGL
     582-2542: Missing.

Show »
Length:581
Mass (Da):59,777
Checksum:i1909744ED03FC919
GO
Isoform 6 (identifier: Q8IWZ3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2524-2542: IWPGTWAPHIGNMHLKYVN → ASLLPSVPAL...GAGDRGRDTR

Show »
Length:2,617
Mass (Da):277,175
Checksum:i2C93ED2B397C7CA6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PDP5E9PDP5_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
1,565Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BLS9H3BLS9_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
687Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2F5H7C2F5_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
608Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4P6H0Y4P6_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
1,215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MQZ8A0A0A0MQZ8_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
866Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHC4D6RHC4_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
368Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y472H0Y472_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
1,072Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7Y3H0Y7Y3_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
934Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y785H0Y785_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
1,024Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C2E1H7C2E1_HUMAN
Ankyrin repeat and KH domain-contai...
ANKHD1
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91417 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB13958 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035291175L → M1 PublicationCorresponds to variant dbSNP:rs17850570Ensembl.1
Natural variantiVAR_035292228G → C1 PublicationCorresponds to variant dbSNP:rs17850572Ensembl.1
Natural variantiVAR_0482811586G → S. Corresponds to variant dbSNP:rs1051309Ensembl.1
Natural variantiVAR_0352931760N → S. Corresponds to variant dbSNP:rs3752704Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028452154 – 164Missing in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_028453559 – 581ANVHA…ENGHT → QAGGHEDYFGGHRSGQASGE GGL in isoform 5. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_028454582 – 2542Missing in isoform 5. 1 PublicationAdd BLAST1961
Alternative sequenceiVSP_028455595 – 627EHESE…KGANV → DKQEDMKTILEGIDPAKHQV RVAFDACKLLRKE in isoform 2 and isoform 3. 3 PublicationsAdd BLAST33
Alternative sequenceiVSP_028456628 – 2542Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST1915
Alternative sequenceiVSP_0284572342 – 2343SS → SCDSPIPSVSSGSSSPLSA in isoform 4. 1 Publication2
Alternative sequenceiVSP_0284582524 – 2542IWPGT…LKYVN → VKWA in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0442312524 – 2542IWPGT…LKYVN → ASLLPSVPALKGEIPSPQLT RPKKRIGRPMVASPNQRHQD HLRPKVPAGVQELTHCPDTP LLPPSDSRGHNSSNSPSLQA GGAEGAGDRGRDTR in isoform 6. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF521882 mRNA Translation: AAO14943.1
AF521883 mRNA Translation: AAO14944.1
AF258557 mRNA Translation: AAG23760.1
AC008438 Genomic DNA No translation available.
AC011399 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW62055.1
CH471062 Genomic DNA Translation: EAW62058.1
BC004457 mRNA Translation: AAH04457.2
BC009420 mRNA Translation: AAH09420.1
BC009909 mRNA Translation: AAH09909.1
BC117677 mRNA Translation: AAI17678.1
BC117678 mRNA Translation: AAI17679.1
BC127127 mRNA Translation: AAI27128.1
BC150486 mRNA Translation: AAI50487.1
AK000904 mRNA Translation: BAA91417.1 Different initiation.
AK022041 mRNA Translation: BAB13958.1 Different initiation.
AF217646 mRNA Translation: AAG41779.1
AB029008 mRNA Translation: BAA83037.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4225.1 [Q8IWZ3-1]
CCDS43371.1 [Q8IWZ3-2]
CCDS43372.1 [Q8IWZ3-3]
CCDS75319.1 [Q8IWZ3-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001183959.1, NM_001197030.1 [Q8IWZ3-5]
NP_060217.1, NM_017747.2 [Q8IWZ3-1]
NP_060448.1, NM_017978.2 [Q8IWZ3-3]
NP_065741.3, NM_020690.5 [Q8IWZ3-6]
NP_078944.2, NM_024668.3 [Q8IWZ3-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.594084

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360839; ENSP00000354085; ENSG00000131503 [Q8IWZ3-1]
ENST00000394722; ENSP00000378211; ENSG00000131503 [Q8IWZ3-3]
ENST00000394723; ENSP00000378212; ENSG00000131503 [Q8IWZ3-2]
ENST00000616482; ENSP00000478529; ENSG00000131503 [Q8IWZ3-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
404734
54882

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:404734
hsa:54882

UCSC genome browser

More...
UCSCi
uc003lfo.4 human [Q8IWZ3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521882 mRNA Translation: AAO14943.1
AF521883 mRNA Translation: AAO14944.1
AF258557 mRNA Translation: AAG23760.1
AC008438 Genomic DNA No translation available.
AC011399 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW62055.1
CH471062 Genomic DNA Translation: EAW62058.1
BC004457 mRNA Translation: AAH04457.2
BC009420 mRNA Translation: AAH09420.1
BC009909 mRNA Translation: AAH09909.1
BC117677 mRNA Translation: AAI17678.1
BC117678 mRNA Translation: AAI17679.1
BC127127 mRNA Translation: AAI27128.1
BC150486 mRNA Translation: AAI50487.1
AK000904 mRNA Translation: BAA91417.1 Different initiation.
AK022041 mRNA Translation: BAB13958.1 Different initiation.
AF217646 mRNA Translation: AAG41779.1
AB029008 mRNA Translation: BAA83037.1
CCDSiCCDS4225.1 [Q8IWZ3-1]
CCDS43371.1 [Q8IWZ3-2]
CCDS43372.1 [Q8IWZ3-3]
CCDS75319.1 [Q8IWZ3-5]
RefSeqiNP_001183959.1, NM_001197030.1 [Q8IWZ3-5]
NP_060217.1, NM_017747.2 [Q8IWZ3-1]
NP_060448.1, NM_017978.2 [Q8IWZ3-3]
NP_065741.3, NM_020690.5 [Q8IWZ3-6]
NP_078944.2, NM_024668.3 [Q8IWZ3-2]
UniGeneiHs.594084

3D structure databases

ProteinModelPortaliQ8IWZ3
SMRiQ8IWZ3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120230, 62 interactors
135698, 34 interactors
DIPiDIP-36371N
IntActiQ8IWZ3, 30 interactors
MINTiQ8IWZ3
STRINGi9606.ENSP00000354085

PTM databases

iPTMnetiQ8IWZ3
PhosphoSitePlusiQ8IWZ3
SwissPalmiQ8IWZ3

Polymorphism and mutation databases

BioMutaiANKHD1
DMDMi74750718

Proteomic databases

EPDiQ8IWZ3
jPOSTiQ8IWZ3
MaxQBiQ8IWZ3
PaxDbiQ8IWZ3
PeptideAtlasiQ8IWZ3
PRIDEiQ8IWZ3
ProteomicsDBi70935
70936 [Q8IWZ3-2]
70937 [Q8IWZ3-3]
70938 [Q8IWZ3-4]
70939 [Q8IWZ3-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
404734
54882
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360839; ENSP00000354085; ENSG00000131503 [Q8IWZ3-1]
ENST00000394722; ENSP00000378211; ENSG00000131503 [Q8IWZ3-3]
ENST00000394723; ENSP00000378212; ENSG00000131503 [Q8IWZ3-2]
ENST00000616482; ENSP00000478529; ENSG00000131503 [Q8IWZ3-5]
GeneIDi404734
54882
KEGGihsa:404734
hsa:54882
UCSCiuc003lfo.4 human [Q8IWZ3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
404734
54882
DisGeNETi404734
54882
EuPathDBiHostDB:ENSG00000131503.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANKHD1
HGNCiHGNC:24714 ANKHD1
HPAiHPA008718
MIMi610500 gene
neXtProtiNX_Q8IWZ3
OpenTargetsiENSG00000131503
PharmGKBiPA134947858
PA162376432

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
KOG4369 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000153768
HOGENOMiHOG000033942
HOVERGENiHBG071352
InParanoidiQ8IWZ3
KOiK16726
OMAiIIGQPQI
OrthoDBi1115202at2759
PhylomeDBiQ8IWZ3
TreeFamiTF328552

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANKHD1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ANKHD1

Protein Ontology

More...
PROi
PR:Q8IWZ3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000131503 Expressed in 207 organ(s), highest expression level in small intestine Peyer's patch
ExpressionAtlasiQ8IWZ3 baseline and differential
GenevisibleiQ8IWZ3 HS

Family and domain databases

CDDicd00204 ANK, 7 hits
Gene3Di1.25.40.20, 8 hits
3.30.1370.10, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
PfamiView protein in Pfam
PF12796 Ank_2, 9 hits
PF00013 KH_1, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 25 hits
SM00322 KH, 1 hit
SUPFAMiSSF48403 SSF48403, 3 hits
SSF54791 SSF54791, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 20 hits
PS50084 KH_TYPE_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANKH1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IWZ3
Secondary accession number(s): A6NH85
, Q149P2, Q8IWZ2, Q8WY90, Q96G77, Q96GK0, Q9H2U0, Q9HA95, Q9NWG4, Q9UPR7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: March 1, 2003
Last modified: April 10, 2019
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again