Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase UBR2

Gene

UBR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. Required for spermatogenesis, promotes, with Tex19.1, SPO11-dependent recombination foci to accumulate and drive robust homologous chromosome synapsis (By similarity). Polyubiquitinates LINE-1 retrotransposon encoded, LIRE1, which induces degradation, inhibiting LINE-1 retranstoposon mobilization (By similarity).By similarity3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • leucine binding Source: UniProtKB
  • ubiquitin protein ligase activity Source: GO_Central
  • ubiquitin-protein transferase activity Source: Reactome
  • zinc ion binding Source: InterPro

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8IWV8

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase UBR2 (EC:2.3.2.27)
Alternative name(s):
N-recognin-2
RING-type E3 ubiquitin transferase UBR2
Ubiquitin-protein ligase E3-alpha-2
Ubiquitin-protein ligase E3-alpha-II
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBR2
Synonyms:C6orf133, KIAA0349
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000024048.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21289 UBR2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609134 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IWV8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23304

Open Targets

More...
OpenTargetsi
ENSG00000024048

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394621

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UBR2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
73622073

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000561402 – 1755E3 ubiquitin-protein ligase UBR2Add BLAST1754

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IWV8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IWV8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IWV8

PeptideAtlas

More...
PeptideAtlasi
Q8IWV8

PRoteomics IDEntifications database

More...
PRIDEi
Q8IWV8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70909
70910 [Q8IWV8-2]
70911 [Q8IWV8-3]
70912 [Q8IWV8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IWV8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IWV8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Broadly expressed, with highest levels in skeletal muscle, kidney and pancreas. Present in acinar cells of the pancreas (at protein level).2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000024048 Expressed in 240 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_UBR2

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IWV8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA027869
HPA027880

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with UBE2B; promotes the UBE2B-H2A interaction and the ubiquitination of histone H2A by UBE2B and UBR2 (By similarity). Interacts with RECQL4 (PubMed:15317757, PubMed:20835242). Interacts with TEX19; does not lead to TEX19 degradation and stabilizes it (By similarity). Interacts with CASP8 (PubMed:28602583).By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
vifP125043EBI-1237260,EBI-779991From Human immunodeficiency virus type 1 group M subtype B (isolate NY5).

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116896, 90 interactors

Database of interacting proteins

More...
DIPi
DIP-38165N

Protein interaction database and analysis system

More...
IntActi
Q8IWV8, 19 interactors

Molecular INTeraction database

More...
MINTi
Q8IWV8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361990

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11755
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8IWV8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IWV8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8IWV8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1019 – 1054Sequence analysisAdd BLAST36

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING-H2 zinc finger is an atypical RING finger with a His ligand in place of the fourth Cys of the classical motif.
The UBR-type zinc finger forms a pocket that mediates recognition of type 1 N-degrons. It exhibits preference for Arginine in first position, has poor affinity for histidine, and doesn't bind acetylated peptides.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UBR1 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1140 Eukaryota
ENOG410XPQU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153755

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231769

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080426

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IWV8

KEGG Orthology (KO)

More...
KOi
K10626

Identification of Orthologs from Complete Genome Data

More...
OMAi
PEWECAF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G009K

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IWV8

TreeFam database of animal gene trees

More...
TreeFami
TF323875

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003769 ClpS_core
IPR014719 Ribosomal_L7/12_C/ClpS-like
IPR039164 UBR1-like
IPR036390 WH_DNA-bd_sf
IPR003126 Znf_UBR

The PANTHER Classification System

More...
PANTHERi
PTHR21497 PTHR21497, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02617 ClpS, 1 hit
PF02207 zf-UBR, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00396 ZnF_UBR1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 1 hit
SSF54736 SSF54736, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51157 ZF_UBR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8IWV8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASELEPEVQ AIDRSLLECS AEEIAGKWLQ ATDLTREVYQ HLAHYVPKIY
60 70 80 90 100
CRGPNPFPQK EDMLAQHVLL GPMEWYLCGE DPAFGFPKLE QANKPSHLCG
110 120 130 140 150
RVFKVGEPTY SCRDCAVDPT CVLCMECFLG SIHRDHRYRM TTSGGGGFCD
160 170 180 190 200
CGDTEAWKEG PYCQKHELNT SEIEEEEDPL VHLSEDVIAR TYNIFAITFR
210 220 230 240 250
YAVEILTWEK ESELPADLEM VEKSDTYYCM LFNDEVHTYE QVIYTLQKAV
260 270 280 290 300
NCTQKEAIGF ATTVDRDGRR SVRYGDFQYC EQAKSVIVRN TSRQTKPLKV
310 320 330 340 350
QVMHSSIVAH QNFGLKLLSW LGSIIGYSDG LRRILCQVGL QEGPDGENSS
360 370 380 390 400
LVDRLMLSDS KLWKGARSVY HQLFMSSLLM DLKYKKLFAV RFAKNYQQLQ
410 420 430 440 450
RDFMEDDHER AVSVTALSVQ FFTAPTLARM LITEENLMSI IIKTFMDHLR
460 470 480 490 500
HRDAQGRFQF ERYTALQAFK FRRVQSLILD LKYVLISKPT EWSDELRQKF
510 520 530 540 550
LEGFDAFLEL LKCMQGMDPI TRQVGQHIEM EPEWEAAFTL QMKLTHVISM
560 570 580 590 600
MQDWCASDEK VLIEAYKKCL AVLMQCHGGY TDGEQPITLS ICGHSVETIR
610 620 630 640 650
YCVSQEKVSI HLPVSRLLAG LHVLLSKSEV AYKFPELLPL SELSPPMLIE
660 670 680 690 700
HPLRCLVLCA QVHAGMWRRN GFSLVNQIYY YHNVKCRREM FDKDVVMLQT
710 720 730 740 750
GVSMMDPNHF LMIMLSRFEL YQIFSTPDYG KRFSSEITHK DVVQQNNTLI
760 770 780 790 800
EEMLYLIIML VGERFSPGVG QVNATDEIKR EIIHQLSIKP MAHSELVKSL
810 820 830 840 850
PEDENKETGM ESVIEAVAHF KKPGLTGRGM YELKPECAKE FNLYFYHFSR
860 870 880 890 900
AEQSKAEEAQ RKLKRQNRED TALPPPVLPP FCPLFASLVN ILQSDVMLCI
910 920 930 940 950
MGTILQWAVE HNGYAWSESM LQRVLHLIGM ALQEEKQHLE NVTEEHVVTF
960 970 980 990 1000
TFTQKISKPG EAPKNSPSIL AMLETLQNAP YLEVHKDMIR WILKTFNAVK
1010 1020 1030 1040 1050
KMRESSPTSP VAETEGTIME ESSRDKDKAE RKRKAEIARL RREKIMAQMS
1060 1070 1080 1090 1100
EMQRHFIDEN KELFQQTLEL DASTSAVLDH SPVASDMTLT ALGPAQTQVP
1110 1120 1130 1140 1150
EQRQFVTCIL CQEEQEVKVE SRAMVLAAFV QRSTVLSKNR SKFIQDPEKY
1160 1170 1180 1190 1200
DPLFMHPDLS CGTHTSSCGH IMHAHCWQRY FDSVQAKEQR RQQRLRLHTS
1210 1220 1230 1240 1250
YDVENGEFLC PLCECLSNTV IPLLLPPRNI FNNRLNFSDQ PNLTQWIRTI
1260 1270 1280 1290 1300
SQQIKALQFL RKEESTPNNA STKNSENVDE LQLPEGFRPD FRPKIPYSES
1310 1320 1330 1340 1350
IKEMLTTFGT ATYKVGLKVH PNEEDPRVPI MCWGSCAYTI QSIERILSDE
1360 1370 1380 1390 1400
DKPLFGPLPC RLDDCLRSLT RFAAAHWTVA SVSVVQGHFC KLFASLVPND
1410 1420 1430 1440 1450
SHEELPCILD IDMFHLLVGL VLAFPALQCQ DFSGISLGTG DLHIFHLVTM
1460 1470 1480 1490 1500
AHIIQILLTS CTEENGMDQE NPPCEEESAV LALYKTLHQY TGSALKEIPS
1510 1520 1530 1540 1550
GWHLWRSVRA GIMPFLKCSA LFFHYLNGVP SPPDIQVPGT SHFEHLCSYL
1560 1570 1580 1590 1600
SLPNNLICLF QENSEIMNSL IESWCRNSEV KRYLEGERDA IRYPRESNKL
1610 1620 1630 1640 1650
INLPEDYSSL INQASNFSCP KSGGDKSRAP TLCLVCGSLL CSQSYCCQTE
1660 1670 1680 1690 1700
LEGEDVGACT AHTYSCGSGV GIFLRVRECQ VLFLAGKTKG CFYSPPYLDD
1710 1720 1730 1740 1750
YGETDQGLRR GNPLHLCKER FKKIQKLWHQ HSVTEEIGHA QEANQTLVGI

DWQHL
Length:1,755
Mass (Da):200,538
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i04B14FCB13E21808
GO
Isoform 2 (identifier: Q8IWV8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-439: QQLQRDFMED...MLITEENLMS → ERLQSDYVTD...ISAGRSGSPL
     440-1755: Missing.

Show »
Length:439
Mass (Da):49,978
Checksum:iD1A9B29DF254AE1F
GO
Isoform 3 (identifier: Q8IWV8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-496: Missing.
     497-514: RQKFLEGFDAFLELLKCM → MYAGNIPIYKTESRSRNE
     1022-1071: SSRDKDKAER...ELFQQTLELD → HNFRVQGTKT...MKTKNSFSRH
     1072-1755: Missing.

Note: No experimental confirmation available.
Show »
Length:575
Mass (Da):66,052
Checksum:iEC2722AF55B26BD3
GO
Isoform 4 (identifier: Q8IWV8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: QQLQRDFMEDDHERAVSVTALSVQFFTAPT → ERLQSDYVTDDHDREFSVADLSVQIFTVPS

Note: Derived from mouse cDNA data. No experimental confirmation available.
Show »
Length:1,755
Mass (Da):200,540
Checksum:i6FE8C7C600C162EE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti864K → R in BAC86295 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052117172E → D. Corresponds to variant dbSNP:rs6905054Ensembl.1
Natural variantiVAR_0598161095A → P. Corresponds to variant dbSNP:rs6917033Ensembl.1
Natural variantiVAR_0598171095A → S. Corresponds to variant dbSNP:rs6917033Ensembl.1
Natural variantiVAR_0232831095A → T1 PublicationCorresponds to variant dbSNP:rs6917033Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0151661 – 496Missing in isoform 3. 1 PublicationAdd BLAST496
Alternative sequenceiVSP_015167397 – 439QQLQR…ENLMS → ERLQSDYVTDDHDREFSVAD LSVQIFTVPSLFSISAGRSG SPL in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_017130397 – 426QQLQR…FTAPT → ERLQSDYVTDDHDREFSVAD LSVQIFTVPS in isoform 4. CuratedAdd BLAST30
Alternative sequenceiVSP_015168440 – 1755Missing in isoform 2. 1 PublicationAdd BLAST1316
Alternative sequenceiVSP_015169497 – 514RQKFL…LLKCM → MYAGNIPIYKTESRSRNE in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_0151701022 – 1071SSRDK…TLELD → HNFRVQGTKTKLRGREKQRL PDCAEKRSWLRCLKCSGILL MKTKNSFSRH in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0151711072 – 1755Missing in isoform 3. 1 PublicationAdd BLAST684

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY061884 mRNA Translation: AAL32101.1
AK125795 mRNA Translation: BAC86295.1
AL049843 Genomic DNA No translation available.
AL136223 Genomic DNA No translation available.
AL391814 Genomic DNA No translation available.
BC024217 mRNA Translation: AAH24217.1
BC064512 mRNA Translation: AAH64512.1
AB002347 mRNA Translation: BAA20806.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4870.1 [Q8IWV8-1]
CCDS55001.1 [Q8IWV8-2]
CCDS87404.1 [Q8IWV8-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001171730.1, NM_001184801.1 [Q8IWV8-2]
NP_056070.1, NM_015255.2 [Q8IWV8-1]
XP_005249022.1, XM_005248965.4

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.529925

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372899; ENSP00000361990; ENSG00000024048 [Q8IWV8-1]
ENST00000372901; ENSP00000361992; ENSG00000024048 [Q8IWV8-4]
ENST00000372903; ENSP00000361994; ENSG00000024048 [Q8IWV8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23304

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23304

UCSC genome browser

More...
UCSCi
uc003osf.4 human [Q8IWV8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY061884 mRNA Translation: AAL32101.1
AK125795 mRNA Translation: BAC86295.1
AL049843 Genomic DNA No translation available.
AL136223 Genomic DNA No translation available.
AL391814 Genomic DNA No translation available.
BC024217 mRNA Translation: AAH24217.1
BC064512 mRNA Translation: AAH64512.1
AB002347 mRNA Translation: BAA20806.1
CCDSiCCDS4870.1 [Q8IWV8-1]
CCDS55001.1 [Q8IWV8-2]
CCDS87404.1 [Q8IWV8-4]
RefSeqiNP_001171730.1, NM_001184801.1 [Q8IWV8-2]
NP_056070.1, NM_015255.2 [Q8IWV8-1]
XP_005249022.1, XM_005248965.4
UniGeneiHs.529925

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NY2X-ray2.61A/B/C/D/E/F/G/H98-167[»]
3NY3X-ray1.60A98-167[»]
5TDAX-ray0.79A98-168[»]
5TDBX-ray1.10A98-168[»]
5TDDX-ray1.55A98-168[»]
5UM3X-ray1.20A98-167[»]
ProteinModelPortaliQ8IWV8
SMRiQ8IWV8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116896, 90 interactors
DIPiDIP-38165N
IntActiQ8IWV8, 19 interactors
MINTiQ8IWV8
STRINGi9606.ENSP00000361990

PTM databases

iPTMnetiQ8IWV8
PhosphoSitePlusiQ8IWV8

Polymorphism and mutation databases

BioMutaiUBR2
DMDMi73622073

Proteomic databases

EPDiQ8IWV8
MaxQBiQ8IWV8
PaxDbiQ8IWV8
PeptideAtlasiQ8IWV8
PRIDEiQ8IWV8
ProteomicsDBi70909
70910 [Q8IWV8-2]
70911 [Q8IWV8-3]
70912 [Q8IWV8-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372899; ENSP00000361990; ENSG00000024048 [Q8IWV8-1]
ENST00000372901; ENSP00000361992; ENSG00000024048 [Q8IWV8-4]
ENST00000372903; ENSP00000361994; ENSG00000024048 [Q8IWV8-2]
GeneIDi23304
KEGGihsa:23304
UCSCiuc003osf.4 human [Q8IWV8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23304
DisGeNETi23304
EuPathDBiHostDB:ENSG00000024048.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UBR2
HGNCiHGNC:21289 UBR2
HPAiHPA027869
HPA027880
MIMi609134 gene
neXtProtiNX_Q8IWV8
OpenTargetsiENSG00000024048
PharmGKBiPA128394621

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1140 Eukaryota
ENOG410XPQU LUCA
GeneTreeiENSGT00940000153755
HOGENOMiHOG000231769
HOVERGENiHBG080426
InParanoidiQ8IWV8
KOiK10626
OMAiPEWECAF
OrthoDBiEOG091G009K
PhylomeDBiQ8IWV8
TreeFamiTF323875

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ8IWV8

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UBR2 human
EvolutionaryTraceiQ8IWV8

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UBR2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23304

Protein Ontology

More...
PROi
PR:Q8IWV8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000024048 Expressed in 240 organ(s), highest expression level in secondary oocyte
CleanExiHS_UBR2
GenevisibleiQ8IWV8 HS

Family and domain databases

Gene3Di3.30.1390.10, 1 hit
InterProiView protein in InterPro
IPR003769 ClpS_core
IPR014719 Ribosomal_L7/12_C/ClpS-like
IPR039164 UBR1-like
IPR036390 WH_DNA-bd_sf
IPR003126 Znf_UBR
PANTHERiPTHR21497 PTHR21497, 1 hit
PfamiView protein in Pfam
PF02617 ClpS, 1 hit
PF02207 zf-UBR, 1 hit
SMARTiView protein in SMART
SM00396 ZnF_UBR1, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF54736 SSF54736, 1 hit
PROSITEiView protein in PROSITE
PS51157 ZF_UBR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBR2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IWV8
Secondary accession number(s): O15057
, Q4VXK2, Q5TFH6, Q6P2I2, Q6ZUD0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: March 1, 2003
Last modified: December 5, 2018
This is version 154 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again