Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase UBR2

Gene

UBR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. Required for spermatogenesis, promotes, with Tex19.1, SPO11-dependent recombination foci to accumulate and drive robust homologous chromosome synapsis (By similarity). Polyubiquitinates LINE-1 retrotransposon encoded, LIRE1, which induces degradation, inhibiting LINE-1 retranstoposon mobilization (By similarity).By similarity3 Publications

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

GO - Molecular functioni

  • leucine binding Source: UniProtKB
  • ubiquitin protein ligase activity Source: GO_Central
  • ubiquitin-protein transferase activity Source: Reactome
  • zinc ion binding Source: InterPro

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ8IWV8
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase UBR2 (EC:2.3.2.27)
Alternative name(s):
N-recognin-2
RING-type E3 ubiquitin transferase UBR2
Ubiquitin-protein ligase E3-alpha-2
Ubiquitin-protein ligase E3-alpha-II
Gene namesi
Name:UBR2
Synonyms:C6orf133, KIAA0349
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000024048.10
HGNCiHGNC:21289 UBR2
MIMi609134 gene
neXtProtiNX_Q8IWV8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23304
OpenTargetsiENSG00000024048
PharmGKBiPA128394621

Polymorphism and mutation databases

BioMutaiUBR2
DMDMi73622073

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000561402 – 1755E3 ubiquitin-protein ligase UBR2Add BLAST1754

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ8IWV8
MaxQBiQ8IWV8
PaxDbiQ8IWV8
PeptideAtlasiQ8IWV8
PRIDEiQ8IWV8
ProteomicsDBi70909
70910 [Q8IWV8-2]
70911 [Q8IWV8-3]
70912 [Q8IWV8-4]

PTM databases

iPTMnetiQ8IWV8
PhosphoSitePlusiQ8IWV8

Expressioni

Tissue specificityi

Broadly expressed, with highest levels in skeletal muscle, kidney and pancreas. Present in acinar cells of the pancreas (at protein level).2 Publications

Developmental stagei

Expressed in fetal pancreas.1 Publication

Gene expression databases

BgeeiENSG00000024048 Expressed in 240 organ(s), highest expression level in secondary oocyte
CleanExiHS_UBR2
GenevisibleiQ8IWV8 HS

Organism-specific databases

HPAiHPA027869
HPA027880

Interactioni

Subunit structurei

Interacts with UBE2B; promotes the UBE2B-H2A interaction and the ubiquitination of histone H2A by UBE2B and UBR2 (By similarity). Interacts with RECQL4 (PubMed:15317757, PubMed:20835242). Interacts with TEX19; does not lead to TEX19 degradation and stabilizes it (By similarity). Interacts with CASP8 (PubMed:28602583).By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
vifP125043EBI-1237260,EBI-779991From Human immunodeficiency virus type 1 group M subtype B (isolate NY5).

Protein-protein interaction databases

BioGridi116896, 89 interactors
DIPiDIP-38165N
IntActiQ8IWV8, 19 interactors
MINTiQ8IWV8
STRINGi9606.ENSP00000361990

Structurei

Secondary structure

11755
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ8IWV8
SMRiQ8IWV8
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8IWV8

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1019 – 1054Sequence analysisAdd BLAST36

Domaini

The RING-H2 zinc finger is an atypical RING finger with a His ligand in place of the fourth Cys of the classical motif.
The UBR-type zinc finger forms a pocket that mediates recognition of type 1 N-degrons. It exhibits preference for Arginine in first position, has poor affinity for histidine, and doesn't bind acetylated peptides.

Sequence similaritiesi

Belongs to the UBR1 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiKOG1140 Eukaryota
ENOG410XPQU LUCA
GeneTreeiENSGT00530000063055
HOGENOMiHOG000231769
HOVERGENiHBG080426
InParanoidiQ8IWV8
KOiK10626
OMAiPEWECAF
OrthoDBiEOG091G009K
PhylomeDBiQ8IWV8
TreeFamiTF323875

Family and domain databases

Gene3Di3.30.1390.10, 1 hit
InterProiView protein in InterPro
IPR003769 ClpS_core
IPR014719 Ribosomal_L7/12_C/ClpS-like
IPR039164 UBR1-like
IPR036390 WH_DNA-bd_sf
IPR003126 Znf_UBR
PANTHERiPTHR21497 PTHR21497, 1 hit
PfamiView protein in Pfam
PF02617 ClpS, 1 hit
PF02207 zf-UBR, 1 hit
SMARTiView protein in SMART
SM00396 ZnF_UBR1, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF54736 SSF54736, 1 hit
PROSITEiView protein in PROSITE
PS51157 ZF_UBR, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8IWV8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASELEPEVQ AIDRSLLECS AEEIAGKWLQ ATDLTREVYQ HLAHYVPKIY
60 70 80 90 100
CRGPNPFPQK EDMLAQHVLL GPMEWYLCGE DPAFGFPKLE QANKPSHLCG
110 120 130 140 150
RVFKVGEPTY SCRDCAVDPT CVLCMECFLG SIHRDHRYRM TTSGGGGFCD
160 170 180 190 200
CGDTEAWKEG PYCQKHELNT SEIEEEEDPL VHLSEDVIAR TYNIFAITFR
210 220 230 240 250
YAVEILTWEK ESELPADLEM VEKSDTYYCM LFNDEVHTYE QVIYTLQKAV
260 270 280 290 300
NCTQKEAIGF ATTVDRDGRR SVRYGDFQYC EQAKSVIVRN TSRQTKPLKV
310 320 330 340 350
QVMHSSIVAH QNFGLKLLSW LGSIIGYSDG LRRILCQVGL QEGPDGENSS
360 370 380 390 400
LVDRLMLSDS KLWKGARSVY HQLFMSSLLM DLKYKKLFAV RFAKNYQQLQ
410 420 430 440 450
RDFMEDDHER AVSVTALSVQ FFTAPTLARM LITEENLMSI IIKTFMDHLR
460 470 480 490 500
HRDAQGRFQF ERYTALQAFK FRRVQSLILD LKYVLISKPT EWSDELRQKF
510 520 530 540 550
LEGFDAFLEL LKCMQGMDPI TRQVGQHIEM EPEWEAAFTL QMKLTHVISM
560 570 580 590 600
MQDWCASDEK VLIEAYKKCL AVLMQCHGGY TDGEQPITLS ICGHSVETIR
610 620 630 640 650
YCVSQEKVSI HLPVSRLLAG LHVLLSKSEV AYKFPELLPL SELSPPMLIE
660 670 680 690 700
HPLRCLVLCA QVHAGMWRRN GFSLVNQIYY YHNVKCRREM FDKDVVMLQT
710 720 730 740 750
GVSMMDPNHF LMIMLSRFEL YQIFSTPDYG KRFSSEITHK DVVQQNNTLI
760 770 780 790 800
EEMLYLIIML VGERFSPGVG QVNATDEIKR EIIHQLSIKP MAHSELVKSL
810 820 830 840 850
PEDENKETGM ESVIEAVAHF KKPGLTGRGM YELKPECAKE FNLYFYHFSR
860 870 880 890 900
AEQSKAEEAQ RKLKRQNRED TALPPPVLPP FCPLFASLVN ILQSDVMLCI
910 920 930 940 950
MGTILQWAVE HNGYAWSESM LQRVLHLIGM ALQEEKQHLE NVTEEHVVTF
960 970 980 990 1000
TFTQKISKPG EAPKNSPSIL AMLETLQNAP YLEVHKDMIR WILKTFNAVK
1010 1020 1030 1040 1050
KMRESSPTSP VAETEGTIME ESSRDKDKAE RKRKAEIARL RREKIMAQMS
1060 1070 1080 1090 1100
EMQRHFIDEN KELFQQTLEL DASTSAVLDH SPVASDMTLT ALGPAQTQVP
1110 1120 1130 1140 1150
EQRQFVTCIL CQEEQEVKVE SRAMVLAAFV QRSTVLSKNR SKFIQDPEKY
1160 1170 1180 1190 1200
DPLFMHPDLS CGTHTSSCGH IMHAHCWQRY FDSVQAKEQR RQQRLRLHTS
1210 1220 1230 1240 1250
YDVENGEFLC PLCECLSNTV IPLLLPPRNI FNNRLNFSDQ PNLTQWIRTI
1260 1270 1280 1290 1300
SQQIKALQFL RKEESTPNNA STKNSENVDE LQLPEGFRPD FRPKIPYSES
1310 1320 1330 1340 1350
IKEMLTTFGT ATYKVGLKVH PNEEDPRVPI MCWGSCAYTI QSIERILSDE
1360 1370 1380 1390 1400
DKPLFGPLPC RLDDCLRSLT RFAAAHWTVA SVSVVQGHFC KLFASLVPND
1410 1420 1430 1440 1450
SHEELPCILD IDMFHLLVGL VLAFPALQCQ DFSGISLGTG DLHIFHLVTM
1460 1470 1480 1490 1500
AHIIQILLTS CTEENGMDQE NPPCEEESAV LALYKTLHQY TGSALKEIPS
1510 1520 1530 1540 1550
GWHLWRSVRA GIMPFLKCSA LFFHYLNGVP SPPDIQVPGT SHFEHLCSYL
1560 1570 1580 1590 1600
SLPNNLICLF QENSEIMNSL IESWCRNSEV KRYLEGERDA IRYPRESNKL
1610 1620 1630 1640 1650
INLPEDYSSL INQASNFSCP KSGGDKSRAP TLCLVCGSLL CSQSYCCQTE
1660 1670 1680 1690 1700
LEGEDVGACT AHTYSCGSGV GIFLRVRECQ VLFLAGKTKG CFYSPPYLDD
1710 1720 1730 1740 1750
YGETDQGLRR GNPLHLCKER FKKIQKLWHQ HSVTEEIGHA QEANQTLVGI

DWQHL
Length:1,755
Mass (Da):200,538
Last modified:March 1, 2003 - v1
Checksum:i04B14FCB13E21808
GO
Isoform 2 (identifier: Q8IWV8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-439: QQLQRDFMED...MLITEENLMS → ERLQSDYVTD...ISAGRSGSPL
     440-1755: Missing.

Show »
Length:439
Mass (Da):49,978
Checksum:iD1A9B29DF254AE1F
GO
Isoform 3 (identifier: Q8IWV8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-496: Missing.
     497-514: RQKFLEGFDAFLELLKCM → MYAGNIPIYKTESRSRNE
     1022-1071: SSRDKDKAER...ELFQQTLELD → HNFRVQGTKT...MKTKNSFSRH
     1072-1755: Missing.

Note: No experimental confirmation available.
Show »
Length:575
Mass (Da):66,052
Checksum:iEC2722AF55B26BD3
GO
Isoform 4 (identifier: Q8IWV8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: QQLQRDFMEDDHERAVSVTALSVQFFTAPT → ERLQSDYVTDDHDREFSVADLSVQIFTVPS

Note: Derived from mouse cDNA data. No experimental confirmation available.
Show »
Length:1,755
Mass (Da):200,540
Checksum:i6FE8C7C600C162EE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti864K → R in BAC86295 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052117172E → D. Corresponds to variant dbSNP:rs6905054Ensembl.1
Natural variantiVAR_0598161095A → P. Corresponds to variant dbSNP:rs6917033Ensembl.1
Natural variantiVAR_0598171095A → S. Corresponds to variant dbSNP:rs6917033Ensembl.1
Natural variantiVAR_0232831095A → T1 PublicationCorresponds to variant dbSNP:rs6917033Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0151661 – 496Missing in isoform 3. 1 PublicationAdd BLAST496
Alternative sequenceiVSP_015167397 – 439QQLQR…ENLMS → ERLQSDYVTDDHDREFSVAD LSVQIFTVPSLFSISAGRSG SPL in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_017130397 – 426QQLQR…FTAPT → ERLQSDYVTDDHDREFSVAD LSVQIFTVPS in isoform 4. CuratedAdd BLAST30
Alternative sequenceiVSP_015168440 – 1755Missing in isoform 2. 1 PublicationAdd BLAST1316
Alternative sequenceiVSP_015169497 – 514RQKFL…LLKCM → MYAGNIPIYKTESRSRNE in isoform 3. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_0151701022 – 1071SSRDK…TLELD → HNFRVQGTKTKLRGREKQRL PDCAEKRSWLRCLKCSGILL MKTKNSFSRH in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0151711072 – 1755Missing in isoform 3. 1 PublicationAdd BLAST684

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY061884 mRNA Translation: AAL32101.1
AK125795 mRNA Translation: BAC86295.1
AL049843 Genomic DNA No translation available.
AL136223 Genomic DNA No translation available.
AL391814 Genomic DNA No translation available.
BC024217 mRNA Translation: AAH24217.1
BC064512 mRNA Translation: AAH64512.1
AB002347 mRNA Translation: BAA20806.1
CCDSiCCDS4870.1 [Q8IWV8-1]
CCDS55001.1 [Q8IWV8-2]
CCDS87404.1 [Q8IWV8-4]
RefSeqiNP_001171730.1, NM_001184801.1 [Q8IWV8-2]
NP_056070.1, NM_015255.2 [Q8IWV8-1]
XP_005249022.1, XM_005248965.4
UniGeneiHs.529925

Genome annotation databases

EnsembliENST00000372899; ENSP00000361990; ENSG00000024048 [Q8IWV8-1]
ENST00000372901; ENSP00000361992; ENSG00000024048 [Q8IWV8-4]
ENST00000372903; ENSP00000361994; ENSG00000024048 [Q8IWV8-2]
GeneIDi23304
KEGGihsa:23304
UCSCiuc003osf.4 human [Q8IWV8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY061884 mRNA Translation: AAL32101.1
AK125795 mRNA Translation: BAC86295.1
AL049843 Genomic DNA No translation available.
AL136223 Genomic DNA No translation available.
AL391814 Genomic DNA No translation available.
BC024217 mRNA Translation: AAH24217.1
BC064512 mRNA Translation: AAH64512.1
AB002347 mRNA Translation: BAA20806.1
CCDSiCCDS4870.1 [Q8IWV8-1]
CCDS55001.1 [Q8IWV8-2]
CCDS87404.1 [Q8IWV8-4]
RefSeqiNP_001171730.1, NM_001184801.1 [Q8IWV8-2]
NP_056070.1, NM_015255.2 [Q8IWV8-1]
XP_005249022.1, XM_005248965.4
UniGeneiHs.529925

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3NY2X-ray2.61A/B/C/D/E/F/G/H98-167[»]
3NY3X-ray1.60A98-167[»]
5TDAX-ray0.79A98-168[»]
5TDBX-ray1.10A98-168[»]
5TDDX-ray1.55A98-168[»]
5UM3X-ray1.20A98-167[»]
ProteinModelPortaliQ8IWV8
SMRiQ8IWV8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116896, 89 interactors
DIPiDIP-38165N
IntActiQ8IWV8, 19 interactors
MINTiQ8IWV8
STRINGi9606.ENSP00000361990

PTM databases

iPTMnetiQ8IWV8
PhosphoSitePlusiQ8IWV8

Polymorphism and mutation databases

BioMutaiUBR2
DMDMi73622073

Proteomic databases

EPDiQ8IWV8
MaxQBiQ8IWV8
PaxDbiQ8IWV8
PeptideAtlasiQ8IWV8
PRIDEiQ8IWV8
ProteomicsDBi70909
70910 [Q8IWV8-2]
70911 [Q8IWV8-3]
70912 [Q8IWV8-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372899; ENSP00000361990; ENSG00000024048 [Q8IWV8-1]
ENST00000372901; ENSP00000361992; ENSG00000024048 [Q8IWV8-4]
ENST00000372903; ENSP00000361994; ENSG00000024048 [Q8IWV8-2]
GeneIDi23304
KEGGihsa:23304
UCSCiuc003osf.4 human [Q8IWV8-1]

Organism-specific databases

CTDi23304
DisGeNETi23304
EuPathDBiHostDB:ENSG00000024048.10
GeneCardsiUBR2
HGNCiHGNC:21289 UBR2
HPAiHPA027869
HPA027880
MIMi609134 gene
neXtProtiNX_Q8IWV8
OpenTargetsiENSG00000024048
PharmGKBiPA128394621
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1140 Eukaryota
ENOG410XPQU LUCA
GeneTreeiENSGT00530000063055
HOGENOMiHOG000231769
HOVERGENiHBG080426
InParanoidiQ8IWV8
KOiK10626
OMAiPEWECAF
OrthoDBiEOG091G009K
PhylomeDBiQ8IWV8
TreeFamiTF323875

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ8IWV8

Miscellaneous databases

ChiTaRSiUBR2 human
EvolutionaryTraceiQ8IWV8
GeneWikiiUBR2
GenomeRNAii23304
PROiPR:Q8IWV8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000024048 Expressed in 240 organ(s), highest expression level in secondary oocyte
CleanExiHS_UBR2
GenevisibleiQ8IWV8 HS

Family and domain databases

Gene3Di3.30.1390.10, 1 hit
InterProiView protein in InterPro
IPR003769 ClpS_core
IPR014719 Ribosomal_L7/12_C/ClpS-like
IPR039164 UBR1-like
IPR036390 WH_DNA-bd_sf
IPR003126 Znf_UBR
PANTHERiPTHR21497 PTHR21497, 1 hit
PfamiView protein in Pfam
PF02617 ClpS, 1 hit
PF02207 zf-UBR, 1 hit
SMARTiView protein in SMART
SM00396 ZnF_UBR1, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF54736 SSF54736, 1 hit
PROSITEiView protein in PROSITE
PS51157 ZF_UBR, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUBR2_HUMAN
AccessioniPrimary (citable) accession number: Q8IWV8
Secondary accession number(s): O15057
, Q4VXK2, Q5TFH6, Q6P2I2, Q6ZUD0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: March 1, 2003
Last modified: November 7, 2018
This is version 153 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again