Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase BRSK2

Gene

BRSK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine-protein kinase that plays a key role in polarization of neurons and axonogenesis, cell cycle progress and insulin secretion. Phosphorylates CDK16, CDC25C, MAPT/TAU, PAK1 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-529' and 'Ser-579'. Also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in postmitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. Plays a role in the regulation of the mitotic cell cycle progress and the onset of mitosis. Plays a role in the regulation of insulin secretion in response to elevated glucose levels, probably via phosphorylation of CDK16 and PAK1. While BRSK2 phosphorylated at Thr-174 can inhibit insulin secretion (PubMed:22798068), BRSK2 phosphorylated at Thr-260 can promote insulin secretion (PubMed:22669945). Regulates reorganization of the actin cytoskeleton. May play a role in the apoptotic response triggered by endoplasmic reticulum (ER) stress.6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by phosphorylation on Thr-174 by STK11/LKB1.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei48ATPPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei141Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi25 – 33ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATPase binding Source: ParkinsonsUK-UCL
  • ATPase regulator activity Source: ParkinsonsUK-UCL
  • ATP binding Source: UniProtKB
  • magnesium ion binding Source: UniProtKB
  • protein kinase binding Source: Ensembl
  • protein serine/threonine kinase activity Source: UniProtKB
  • tau-protein kinase activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processApoptosis, Cell cycle, Cell division, Exocytosis, Mitosis, Neurogenesis
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8IWQ3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8IWQ3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase BRSK2 (EC:2.7.11.1)
Alternative name(s):
Brain-selective kinase 2 (EC:2.7.11.26)
Brain-specific serine/threonine-protein kinase 2
Short name:
BR serine/threonine-protein kinase 2
Serine/threonine-protein kinase 29
Serine/threonine-protein kinase SAD-A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BRSK2
Synonyms:C11orf7, PEN11B, SADA, STK29
ORF Names:HUSSY-12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000174672.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11405 BRSK2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609236 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IWQ3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Endoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi48K → M: Loss of catalytic activity. Causes disintegration of actin stress fibers. 2 Publications1
Mutagenesisi174T → A: Prevents phosphorylation and activation by STK11/LKB1 complex. 3 Publications1
Mutagenesisi174T → E: Constitutively activated. 3 Publications1
Mutagenesisi260T → A: Decreased phosphorylation. Nearly abolishes stimulation of insulin secretion. 2 Publications1
Mutagenesisi310G → A: Decreased activation of kinase activity. 1 Publication1
Mutagenesisi443T → A: Constitutively activated. Promotes formation of actin stress fibers. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
9024

Open Targets

More...
OpenTargetsi
ENSG00000174672

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36212

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4574

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1947

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BRSK2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116241272

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000856701 – 736Serine/threonine-protein kinase BRSK2Add BLAST736

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei174Phosphothreonine; by LKB12 Publications1
Modified residuei260Phosphothreonine; by PKA1 Publication1
Modified residuei294PhosphoserineBy similarity1
Modified residuei367PhosphoserineCombined sources1
Modified residuei382PhosphoserineCombined sources1
Modified residuei393PhosphoserineCombined sources1
Modified residuei412PhosphoserineCombined sources1
Modified residuei423PhosphoserineBy similarity1
Modified residuei427PhosphoserineBy similarity1
Modified residuei455PhosphoserineBy similarity1
Modified residuei459PhosphothreonineBy similarity1
Modified residuei463PhosphothreonineBy similarity1
Modified residuei509PhosphothreonineCombined sources1
Modified residuei512PhosphoserineBy similarity1
Modified residuei513PhosphoserineBy similarity1
Modified residuei520PhosphoserineBy similarity1
Isoform 4 (identifier: Q8IWQ3-4)
Modified residuei416PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Thr-174 by STK11/LKB1 in complex with STE20-related adapter-alpha (STRADA) pseudo kinase and CAB39. Not phosphorylated at Thr-174 by CaMKK2. In contrast, it is phosphorylated and activated by CaMKK1. May be inactivated via dephosphorylation of Thr-174 by PP2C. Phosphorylated at Thr-260 by PKA. Phosphorylation at Thr-260 by PKA was not observed in another study (PubMed:18339622), but this may reflect differences in the experimental approach. Phosphorylation at Thr-260 seems to play a role in the regulation of insulin secretion (PubMed:22669945).5 Publications
Polyubiquitinated by the APC complex in conjunction with FZR1, leading to its proteasomal degradation. Targeted for proteasomal degradation by interaction with COPS5. BRSK2 levels change during the cell cycle. BRSK2 levels are low at the G1/S boundary and gradually increase as cells progress into G2 phase. BRSK2 levels decrease rapidly at the end of mitosis.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IWQ3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IWQ3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IWQ3

PeptideAtlas

More...
PeptideAtlasi
Q8IWQ3

PRoteomics IDEntifications database

More...
PRIDEi
Q8IWQ3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70877
70878 [Q8IWQ3-2]
70879 [Q8IWQ3-3]
70880 [Q8IWQ3-4]
70881 [Q8IWQ3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IWQ3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IWQ3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in pancreas islets (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000174672 Expressed in 102 organ(s), highest expression level in right hemisphere of cerebellum

CleanEx database of gene expression profiles

More...
CleanExi
HS_BRSK2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IWQ3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IWQ3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA073690

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FZR1, a regulatory subunit of the APC ubiquitin ligase complex. Interacts with COPS5. Interacts with PAK1.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114491, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q8IWQ3, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000310697

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q8IWQ3

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8IWQ3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IWQ3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 270Protein kinasePROSITE-ProRule annotationAdd BLAST252
Domaini297 – 339UBAAdd BLAST43

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi603 – 605KEN box3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi424 – 468Pro-richAdd BLAST45

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The KEN box motif is required for interaction with FZR1/CDH1 and essential for APC(CDH1)-mediated ubiquitination.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0588 Eukaryota
ENOG410XNQ0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157462

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000246447

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG007240

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IWQ3

KEGG Orthology (KO)

More...
KOi
K08796

Identification of Orthologs from Complete Genome Data

More...
OMAi
TKHSANS

Database of Orthologous Groups

More...
OrthoDBi
EOG091G02CG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IWQ3

TreeFam database of animal gene trees

More...
TreeFami
TF313967

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IWQ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSTGKDGGA QHAQYVGPYR LEKTLGKGQT GLVKLGVHCV TCQKVAIKIV
60 70 80 90 100
NREKLSESVL MKVEREIAIL KLIEHPHVLK LHDVYENKKY LYLVLEHVSG
110 120 130 140 150
GELFDYLVKK GRLTPKEARK FFRQIISALD FCHSHSICHR DLKPENLLLD
160 170 180 190 200
EKNNIRIADF GMASLQVGDS LLETSCGSPH YACPEVIRGE KYDGRKADVW
210 220 230 240 250
SCGVILFALL VGALPFDDDN LRQLLEKVKR GVFHMPHFIP PDCQSLLRGM
260 270 280 290 300
IEVDAARRLT LEHIQKHIWY IGGKNEPEPE QPIPRKVQIR SLPSLEDIDP
310 320 330 340 350
DVLDSMHSLG CFRDRNKLLQ DLLSEEENQE KMIYFLLLDR KERYPSQEDE
360 370 380 390 400
DLPPRNEIDP PRKRVDSPML NRHGKRRPER KSMEVLSVTD GGSPVPARRA
410 420 430 440 450
IEMAQHGQRS RSISGASSGL STSPLSSPRV TPHPSPRGSP LPTPKGTPVH
460 470 480 490 500
TPKESPAGTP NPTPPSSPSV GGVPWRARLN SIKNSFLGSP RFHRRKLQVP
510 520 530 540 550
TPEEMSNLTP ESSPELAKKS WFGNFISLEK EEQIFVVIKD KPLSSIKADI
560 570 580 590 600
VHAFLSIPSL SHSVISQTSF RAEYKATGGP AVFQKPVKFQ VDITYTEGGE
610 620 630 640 650
AQKENGIYSV TFTLLSGPSR RFKRVVETIQ AQLLSTHDPP AAQHLSDTTN
660 670 680 690 700
CMEMMTGRLS KCGSPLSNFF DVIKQLFSDE KNGQAAQAPS TPAKRSAHGP
710 720 730
LGDSAAAGPG PGGDAEYPTG KDTAKMGPPT ARREQP
Length:736
Mass (Da):81,633
Last modified:October 17, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD9EBA511149449E6
GO
Isoform 2 (identifier: Q8IWQ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     647-674: DTTNCMEMMTGRLSKCGSPLSNFFDVIK → EPPPPAPGLSWGAGLKGQKVATSYESSL
     675-736: Missing.

Show »
Length:674
Mass (Da):75,149
Checksum:iE7E6704028A00876
GO
Isoform 3 (identifier: Q8IWQ3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     664-668: SPLSN → IIPKS
     669-736: Missing.

Show »
Length:668
Mass (Da):74,741
Checksum:i2E3BE2942B8BD79B
GO
Isoform 4 (identifier: Q8IWQ3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     408-408: Q → QSKAMFSKSLDIAEAHPQFSKED
     647-674: DTTNCMEMMTGRLSKCGSPLSNFFDVIK → EPPPPAPGLSWGAGLKGQKVATSYESSL
     675-736: Missing.

Show »
Length:696
Mass (Da):77,598
Checksum:i857FBFE1ED9B3672
GO
Isoform 5 (identifier: Q8IWQ3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MTSTGKDGGAQHAQYVGPYRLEKTLGKGQT → MSPEGHPSRW...TWLCLQPSPA
     663-678: Missing.

Note: No experimental confirmation available.
Show »
Length:766
Mass (Da):84,832
Checksum:iB0E5187AF729E947
GO
Isoform 6 (identifier: Q8IWQ3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: Missing.
     647-674: DTTNCMEMMTGRLSKCGSPLSNFFDVIK → EPPPPAPGLSWGAGLKGQKVATSYESSL
     675-736: Missing.

Note: No experimental confirmation available.
Show »
Length:614
Mass (Da):68,740
Checksum:iA2CBD024EB3321B9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PPI2E9PPI2_HUMAN
Serine/threonine-protein kinase BRS...
BRSK2
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCS6H0YCS6_HUMAN
Serine/threonine-protein kinase BRS...
BRSK2
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRY3E9PRY3_HUMAN
Serine/threonine-protein kinase BRS...
BRSK2
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YES6H0YES6_HUMAN
Serine/threonine-protein kinase BRS...
BRSK2
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGH9A0A0C4DGH9_HUMAN
Serine/threonine-protein kinase BRS...
BRSK2
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD09654 differs from that shown. Reason: Frameshift at position 640.Curated
The sequence AAD09654 differs from that shown. Reason: Erroneous termination at position 663. Translated as Gly.Curated
The sequence AAH24291 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti251I → S in AAP97723 (Ref. 2) Curated1
Sequence conflicti251I → S in AAP97724 (Ref. 2) Curated1
Sequence conflicti251I → S in AAP97725 (Ref. 2) Curated1
Sequence conflicti251I → S in AAP97726 (Ref. 2) Curated1
Sequence conflicti251I → S in AAP97727 (Ref. 2) Curated1
Sequence conflicti251I → S in AAN87839 (Ref. 2) Curated1
Sequence conflicti251I → S in CAA07196 (PubMed:11124703).Curated1
Sequence conflicti409R → G in BAG53761 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0556791 – 60Missing in isoform 6. CuratedAdd BLAST60
Alternative sequenceiVSP_0226031 – 30MTSTG…GKGQT → MSPEGHPSRWARPRRPCICP SSLCSPREPRSGPAVGRGGA AHHRVPAGHTPGPQLLQPHL HLPQGQTWLCLQPSPA in isoform 5. CuratedAdd BLAST30
Alternative sequenceiVSP_013945408Q → QSKAMFSKSLDIAEAHPQFS KED in isoform 4. 1 Publication1
Alternative sequenceiVSP_008154647 – 674DTTNC…FDVIK → EPPPPAPGLSWGAGLKGQKV ATSYESSL in isoform 2, isoform 4 and isoform 6. 4 PublicationsAdd BLAST28
Alternative sequenceiVSP_022604663 – 678Missing in isoform 5. CuratedAdd BLAST16
Alternative sequenceiVSP_008156664 – 668SPLSN → IIPKS in isoform 3. 2 Publications5
Alternative sequenceiVSP_008157669 – 736Missing in isoform 3. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_008155675 – 736Missing in isoform 2, isoform 4 and isoform 6. 4 PublicationsAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY505125 mRNA Translation: AAS86443.1
AF533876 mRNA Translation: AAP97723.1
AF533877 mRNA Translation: AAP97724.1
AF533878 mRNA Translation: AAP97725.1
AF533879 mRNA Translation: AAP97726.1
AF533880 mRNA Translation: AAP97727.1
AY166857 mRNA Translation: AAN87839.1
AK122851 mRNA Translation: BAG53761.1
AK131534 mRNA Translation: BAD18671.1
AC091196 Genomic DNA No translation available.
AC136297 Genomic DNA No translation available.
AJ006701 mRNA Translation: CAA07196.1
BC024291 mRNA Translation: AAH24291.1 Different initiation.
AF020089 mRNA Translation: AAD09654.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41590.1 [Q8IWQ3-3]
CCDS58106.1 [Q8IWQ3-2]
CCDS58107.1 [Q8IWQ3-1]
CCDS58108.1 [Q8IWQ3-5]
CCDS60696.1 [Q8IWQ3-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001243556.1, NM_001256627.1 [Q8IWQ3-1]
NP_001243558.1, NM_001256629.1 [Q8IWQ3-2]
NP_001243559.1, NM_001256630.1 [Q8IWQ3-5]
NP_001269147.1, NM_001282218.1 [Q8IWQ3-6]
NP_003948.2, NM_003957.3 [Q8IWQ3-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.170819

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000308219; ENSP00000310697; ENSG00000174672 [Q8IWQ3-3]
ENST00000382179; ENSP00000371614; ENSG00000174672 [Q8IWQ3-5]
ENST00000526678; ENSP00000433370; ENSG00000174672 [Q8IWQ3-4]
ENST00000528710; ENSP00000433235; ENSG00000174672 [Q8IWQ3-6]
ENST00000528841; ENSP00000432000; ENSG00000174672 [Q8IWQ3-1]
ENST00000529433; ENSP00000433684; ENSG00000174672 [Q8IWQ3-2]
ENST00000531197; ENSP00000431152; ENSG00000174672 [Q8IWQ3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9024

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9024

UCSC genome browser

More...
UCSCi
uc001lti.5 human [Q8IWQ3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY505125 mRNA Translation: AAS86443.1
AF533876 mRNA Translation: AAP97723.1
AF533877 mRNA Translation: AAP97724.1
AF533878 mRNA Translation: AAP97725.1
AF533879 mRNA Translation: AAP97726.1
AF533880 mRNA Translation: AAP97727.1
AY166857 mRNA Translation: AAN87839.1
AK122851 mRNA Translation: BAG53761.1
AK131534 mRNA Translation: BAD18671.1
AC091196 Genomic DNA No translation available.
AC136297 Genomic DNA No translation available.
AJ006701 mRNA Translation: CAA07196.1
BC024291 mRNA Translation: AAH24291.1 Different initiation.
AF020089 mRNA Translation: AAD09654.1 Sequence problems.
CCDSiCCDS41590.1 [Q8IWQ3-3]
CCDS58106.1 [Q8IWQ3-2]
CCDS58107.1 [Q8IWQ3-1]
CCDS58108.1 [Q8IWQ3-5]
CCDS60696.1 [Q8IWQ3-6]
RefSeqiNP_001243556.1, NM_001256627.1 [Q8IWQ3-1]
NP_001243558.1, NM_001256629.1 [Q8IWQ3-2]
NP_001243559.1, NM_001256630.1 [Q8IWQ3-5]
NP_001269147.1, NM_001282218.1 [Q8IWQ3-6]
NP_003948.2, NM_003957.3 [Q8IWQ3-3]
UniGeneiHs.170819

3D structure databases

ProteinModelPortaliQ8IWQ3
SMRiQ8IWQ3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114491, 10 interactors
IntActiQ8IWQ3, 3 interactors
STRINGi9606.ENSP00000310697

Chemistry databases

BindingDBiQ8IWQ3
ChEMBLiCHEMBL4574
GuidetoPHARMACOLOGYi1947

PTM databases

iPTMnetiQ8IWQ3
PhosphoSitePlusiQ8IWQ3

Polymorphism and mutation databases

BioMutaiBRSK2
DMDMi116241272

Proteomic databases

EPDiQ8IWQ3
MaxQBiQ8IWQ3
PaxDbiQ8IWQ3
PeptideAtlasiQ8IWQ3
PRIDEiQ8IWQ3
ProteomicsDBi70877
70878 [Q8IWQ3-2]
70879 [Q8IWQ3-3]
70880 [Q8IWQ3-4]
70881 [Q8IWQ3-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
9024
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308219; ENSP00000310697; ENSG00000174672 [Q8IWQ3-3]
ENST00000382179; ENSP00000371614; ENSG00000174672 [Q8IWQ3-5]
ENST00000526678; ENSP00000433370; ENSG00000174672 [Q8IWQ3-4]
ENST00000528710; ENSP00000433235; ENSG00000174672 [Q8IWQ3-6]
ENST00000528841; ENSP00000432000; ENSG00000174672 [Q8IWQ3-1]
ENST00000529433; ENSP00000433684; ENSG00000174672 [Q8IWQ3-2]
ENST00000531197; ENSP00000431152; ENSG00000174672 [Q8IWQ3-2]
GeneIDi9024
KEGGihsa:9024
UCSCiuc001lti.5 human [Q8IWQ3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9024
DisGeNETi9024
EuPathDBiHostDB:ENSG00000174672.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BRSK2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0009361
HGNCiHGNC:11405 BRSK2
HPAiHPA073690
MIMi609236 gene
neXtProtiNX_Q8IWQ3
OpenTargetsiENSG00000174672
PharmGKBiPA36212

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0588 Eukaryota
ENOG410XNQ0 LUCA
GeneTreeiENSGT00940000157462
HOGENOMiHOG000246447
HOVERGENiHBG007240
InParanoidiQ8IWQ3
KOiK08796
OMAiTKHSANS
OrthoDBiEOG091G02CG
PhylomeDBiQ8IWQ3
TreeFamiTF313967

Enzyme and pathway databases

SignaLinkiQ8IWQ3
SIGNORiQ8IWQ3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BRSK2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BRSK2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9024

Protein Ontology

More...
PROi
PR:Q8IWQ3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000174672 Expressed in 102 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_BRSK2
ExpressionAtlasiQ8IWQ3 baseline and differential
GenevisibleiQ8IWQ3 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBRSK2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IWQ3
Secondary accession number(s): B3KVE9
, E9PLM7, O60843, O95099, Q5J5B4, Q6ZMQ4, Q8TB60
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: October 17, 2006
Last modified: December 5, 2018
This is version 166 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again