Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAX gene-associated protein

Gene

MGA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi84 – 260T-boxPROSITE-ProRule annotationAdd BLAST177

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8953750 Transcriptional Regulation by E2F6

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8IWI9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MAX gene-associated protein
Alternative name(s):
MAX dimerization protein 5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MGA
Synonyms:KIAA0518, MAD5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000174197.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14010 MGA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616061 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IWI9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23269

Open Targets

More...
OpenTargetsi
ENSG00000174197

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134976336

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MGA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
527504082

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003426921 – 3026MAX gene-associated proteinAdd BLAST3026

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki4Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki178Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki323Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki329Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki349Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki432Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki460Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki465Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki482Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei534PhosphoserineCombined sources1
Cross-linki570Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei607PhosphoserineCombined sources1
Cross-linki613Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei645PhosphoserineCombined sources1
Cross-linki654Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki785Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki791Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki817Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki826Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei851PhosphoserineCombined sources1
Modified residuei924PhosphoserineCombined sources1
Cross-linki928Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki990Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1091Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1140Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1162Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1199Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1207Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1208PhosphoserineCombined sources1
Modified residuei1430PhosphoserineCombined sources1
Modified residuei1457PhosphoserineCombined sources1
Cross-linki1461Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1502Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1946Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1953Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2064Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2074Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2096Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2100Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2107Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2120Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2155Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2167Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2199Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei2226Omega-N-methylarginineCombined sources1
Cross-linki2245Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2339Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2374Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2493Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei2502PhosphoserineCombined sources1
Cross-linki2507Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2590Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2640Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2659Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2745Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei2871PhosphoserineCombined sources1
Modified residuei2882PhosphoserineCombined sources1
Modified residuei2939PhosphoserineCombined sources1
Cross-linki3002Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 3 (identifier: Q8IWI9-3)
Modified residuei1552Asymmetric dimethylarginineCombined sources1
Modified residuei1566Asymmetric dimethylarginineCombined sources1
Isoform 4 (identifier: Q8IWI9-4)
Modified residuei1761Asymmetric dimethylarginineCombined sources1
Modified residuei1775Asymmetric dimethylarginineCombined sources1

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IWI9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IWI9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IWI9

PeptideAtlas

More...
PeptideAtlasi
Q8IWI9

PRoteomics IDEntifications database

More...
PRIDEi
Q8IWI9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70860
70861 [Q8IWI9-2]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q8IWI9

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IWI9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IWI9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000174197 Expressed in 229 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_MGA

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IWI9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IWI9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042278
HPA058183

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAX. Requires dimerization with MAX for E-box binding (By similarity). Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with ZMYND11.By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
MAXP612444EBI-2815196,EBI-751711

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116870, 66 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8IWI9

Database of interacting proteins

More...
DIPi
DIP-57615N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q8IWI9

Protein interaction database and analysis system

More...
IntActi
Q8IWI9, 48 interactors

Molecular INTeraction database

More...
MINTi
Q8IWI9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000219905

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8IWI9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IWI9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2384 – 2435bHLHPROSITE-ProRule annotationAdd BLAST52

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1111 – 1147Sequence analysisAdd BLAST37
Coiled coili2778 – 2802Sequence analysisAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi967 – 981Gln-richAdd BLAST15
Compositional biasi1255 – 1263Poly-Ser9
Compositional biasi1594 – 1714Thr-richAdd BLAST121

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Transcription repression is enhanced or dependent on the presence of the T-box DNA-binding domain.By similarity

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3585 Eukaryota
ENOG410XSTS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156269

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113578

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108131

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IWI9

Identification of Orthologs from Complete Genome Data

More...
OMAi
MQEAQEF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0I8R

TreeFam database of animal gene trees

More...
TreeFami
TF106341

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00083 HLH, 1 hit
cd00182 TBOX, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.820, 1 hit
4.10.280.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011598 bHLH_dom
IPR032060 DUF4801
IPR036638 HLH_DNA-bd_sf
IPR037935 MAX_gene-associated_protein
IPR008967 p53-like_TF_DNA-bd
IPR036960 T-box_sf
IPR001699 TF_T-box
IPR018186 TF_T-box_CS

The PANTHER Classification System

More...
PANTHERi
PTHR11267 PTHR11267, 2 hits
PTHR11267:SF32 PTHR11267:SF32, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16059 DUF4801, 1 hit
PF00010 HLH, 1 hit
PF00907 T-box, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00937 TBOX

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00353 HLH, 1 hit
SM00425 TBOX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47459 SSF47459, 1 hit
SSF49417 SSF49417, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50888 BHLH, 1 hit
PS01264 TBOX_2, 1 hit
PS50252 TBOX_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IWI9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEKQQIILA NQDGGTVAGA APTFFVILKQ PGNGKTDQGI LVTNQDACAL
60 70 80 90 100
ASSVSSPVKS KGKICLPADC TVGGITVTLD NNSMWNEFYH RSTEMILTKQ
110 120 130 140 150
GRRMFPYCRY WITGLDSNLK YILVMDISPV DNHRYKWNGR WWEPSGKAEP
160 170 180 190 200
HVLGRVFIHP ESPSTGHYWM HQPVSFYKLK LTNNTLDQEG HIILHSMHRY
210 220 230 240 250
LPRLHLVPAE KAVEVIQLNG PGVHTFTFPQ TEFFAVTAYQ NIQITQLKID
260 270 280 290 300
YNPFAKGFRD DGLNNKPQRD GKQKNSSDQE GNNISSSSGH RVRLTEGQGS
310 320 330 340 350
EIQPGDLDPL SRGHETSGKG LEKTSLNIKR DFLGFMDTDS ALSEVPQLKQ
360 370 380 390 400
EISECLIASS FEDDSRVASP LDQNGSFNVV IKEEPLDDYD YELGECPEGV
410 420 430 440 450
TVKQEETDEE TDVYSNSDDD PILEKQLKRH NKVDNPEADH LSSKWLPSSP
460 470 480 490 500
SGVAKAKMFK LDTGKMPVVY LEPCAVTRST VKISELPDNM LSTSRKDKSS
510 520 530 540 550
MLAELEYLPT YIENSNETAF CLGKESENGL RKHSPDLRVV QKYPLLKEPQ
560 570 580 590 600
WKYPDISDSI STERILDDSK DSVGDSLSGK EDLGRKRTTM LKIATAAKVV
610 620 630 640 650
NANQNASPNV PGKRGRPRKL KLCKAGRPPK NTGKSLISTK NTPVSPGSTF
660 670 680 690 700
PDVKPDLEDV DGVLFVSFES KEALDIHAVD GTTEESSSLQ ASTTNDSGYR
710 720 730 740 750
ARISQLEKEL IEDLKTLRHK QVIHPGLQEV GLKLNSVDPT MSIDLKYLGV
760 770 780 790 800
QLPLAPATSF PFWNLTGTNP ASPDAGFPFV SRTGKTNDFT KIKGWRGKFH
810 820 830 840 850
SASASRNEGG NSESSLKNRS AFCSDKLDEY LENEGKLMET SMGFSSNAPT
860 870 880 890 900
SPVVYQLPTK STSYVRTLDS VLKKQSTISP STSYSLKPHS VPPVSRKAKS
910 920 930 940 950
QNRQATFSGR TKSSYKSILP YPVSPKQKYS HVILGDKVTK NSSGIISENQ
960 970 980 990 1000
ANNFVVPTLD ENIFPKQISL RQAQQQQQQQ QGSRPPGLSK SQVKLMDLED
1010 1020 1030 1040 1050
CALWEGKPRT YITEERADVS LTTLLTAQAS LKTKPIHTII RKRAPPCNND
1060 1070 1080 1090 1100
FCRLGCVCSS LALEKRQPAH CRRPDCMFGC TCLKRKVVLV KGGSKTKHFQ
1110 1120 1130 1140 1150
RKAAHRDPVF YDTLGEEARE EEEGIREEEE QLKEKKKRKK LEYTICETEP
1160 1170 1180 1190 1200
EQPVRHYPLW VKVEGEVDPE PVYIPTPSVI EPMKPLLLPQ PEVLSPTVKG
1210 1220 1230 1240 1250
KLLTGIKSPR SYTPKPNPVI REEDKDPVYL YFESMMTCAR VRVYERKKED
1260 1270 1280 1290 1300
QRQPSSSSSP SPSFQQQTSC HSSPENHNNA KEPDSEQQPL KQLTCDLEDD
1310 1320 1330 1340 1350
SDKLQEKSWK SSCNEGESSS TSYMHQRSPG GPTKLIEIIS DCNWEEDRNK
1360 1370 1380 1390 1400
ILSILSQHIN SNMPQSLKVG SFIIELASQR KSRGEKNPPV YSSRVKISMP
1410 1420 1430 1440 1450
SCQDQDDMAE KSGSETPDGP LSPGKMEDIS PVQTDALDSV RERLHGGKGL
1460 1470 1480 1490 1500
PFYAGLSPAG KLVAYKRKPS SSTSGLIQVA SNAKVAASRK PRTLLPSTSN
1510 1520 1530 1540 1550
SKMASSSGTA TNRPGKNLKA FVPAKRPIAA RPSPGGVFTQ FVMSKVGALQ
1560 1570 1580 1590 1600
QKIPGVSTPQ TLAGTQKFSI RPSPVMVVTP VVSSEPVQVC SPVTAAVTTT
1610 1620 1630 1640 1650
TPQVFLENTT AVTPMTAISD VETKETTYSS GATTTGVVEV SETNTSTSVT
1660 1670 1680 1690 1700
STQSTATVNL TKTTGITTPV ASVAFPKSLV ASPSTITLPV ASTASTSLVV
1710 1720 1730 1740 1750
VTAAASSSMV TTPTSSLGSV PIILSGINGS PPVSQRPENA AQIPVATPQV
1760 1770 1780 1790 1800
SPNTVKRAGP RLLHPNGQIV QLLPLHQLRG SNTQPNLQPV MFRNPGSVMG
1810 1820 1830 1840 1850
IRLPAPSKPS ETPPSSTSSS AFSVMNPVIQ AVGSSSAVNV ITQAPSLLSS
1860 1870 1880 1890 1900
GASFVSQAGT LTLRISPPEP QSFASKTGSE TKITYSSGGQ PVGTASLIPL
1910 1920 1930 1940 1950
QSGSFALLQL PGQKPVPSSI LQHVASLQMK RESQNPDQKD ETNSIKREQE
1960 1970 1980 1990 2000
TKKVLQSEGE AVDPEANVIK QNSGAATSEE TLNDSLEDRG DHLDEECLPE
2010 2020 2030 2040 2050
EGCATVKPSE HSCITGSHTD QDYKDVNEEY GARNRKSSKE KVAVLEVRTI
2060 2070 2080 2090 2100
SEKASNKTVQ NLSKVQHQKL GDVKVEQQKG FDNPEENSSE FPVTFKEESK
2110 2120 2130 2140 2150
FELSGSKVME QQSNLQPEAK EKECGDSLEK DRERWRKHLK GPLTRKCVGA
2160 2170 2180 2190 2200
SQECKKEADE QLIKETKTCQ ENSDVFQQEQ GISDLLGKSG ITEDARVLKT
2210 2220 2230 2240 2250
ECDSWSRISN PSAFSIVPRR AAKSSRGNGH FQGHLLLPGE QIQPKQEKKG
2260 2270 2280 2290 2300
GRSSADFTVL DLEEDDEDDN EKTDDSIDEI VDVVSDYQSE EVDDVEKNNC
2310 2320 2330 2340 2350
VEYIEDDEEH VDIETVEELS EEINVAHLKT TAAHTQSFKQ PSCTHISADE
2360 2370 2380 2390 2400
KAAERSRKAP PIPLKLKPDY WSDKLQKEAE AFAYYRRTHT ANERRRRGEM
2410 2420 2430 2440 2450
RDLFEKLKIT LGLLHSSKVS KSLILTRAFS EIQGLTDQAD KLIGQKNLLT
2460 2470 2480 2490 2500
RKRNILIRKV SSLSGKTEEV VLKKLEYIYA KQQALEAQKR KKKMGSDEFD
2510 2520 2530 2540 2550
ISPRISKQQE GSSASSVDLG QMFINNRRGK PLILSRKKDQ ATENTSPLNT
2560 2570 2580 2590 2600
PHTSANLVMT PQGQLLTLKG PLFSGPVVAV SPDLLESDLK PQVAGSAVAL
2610 2620 2630 2640 2650
PENDDLFMMP RIVNVTSLAT EGGLVDMGGS KYPHEVPDSK PSDHLKDTVR
2660 2670 2680 2690 2700
NEDNSLEDKG RISSRGNRDG RVTLGPTQVF LANKDSGYPQ IVDVSNMQKA
2710 2720 2730 2740 2750
QEFLPKKISG DMRGIQYKWK ESESRGERVK SKDSSFHKLK MKDLKDSSIE
2760 2770 2780 2790 2800
MELRKVTSAI EEAALDSSEL LTNMEDEDDT DETLTSLLNE IAFLNQQLND
2810 2820 2830 2840 2850
DSVGLAELPS SMDTEFPGDA RRAFISKVPP GSRATFQVEH LGTGLKELPD
2860 2870 2880 2890 2900
VQGESDSISP LLLHLEDDDF SENEKQLAEP ASEPDVLKIV IDSEIKDSLL
2910 2920 2930 2940 2950
SNKKAIDGGK NTSGLPAEPE SVSSPPTLHM KTGLENSNST DTLWRPMPKL
2960 2970 2980 2990 3000
APLGLKVANP SSDADGQSLK VMPCLAPIAA KVGSVGHKMN LTGNDQEGRE
3010 3020
SKVMPTLAPV VAKLGNSGAS PSSAGK
Length:3,026
Mass (Da):331,836
Last modified:July 24, 2013 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i33D363321F6E40CD
GO
Isoform 2 (identifier: Q8IWI9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1790: Missing.
     2488-3026: Missing.

Note: No experimental confirmation available.
Show »
Length:697
Mass (Da):77,234
Checksum:i6F8E87B777DD16BE
GO
Isoform 3 (identifier: Q8IWI9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1529-1763: AARPSPGGVF...TVKRAGPRLL → ENAAQIPVAT...RSPSGMNLFR

Note: No experimental confirmation available.Combined sources
Show »
Length:2,856
Mass (Da):315,219
Checksum:iE79165E8AF0C9FE6
GO
Isoform 4 (identifier: Q8IWI9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1763-1763: L → LLIPVQQGSPTLRPVSNTQLQGHRMVLQPVRSPSGMNLFR

Note: No experimental confirmation available.Combined sources
Show »
Length:3,065
Mass (Da):336,159
Checksum:i430B04B7ED92B4A8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BTF4H3BTF4_HUMAN
MAX gene-associated protein
MGA
1,138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BP52H3BP52_HUMAN
MAX gene-associated protein
MGA
1,086Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU53H3BU53_HUMAN
MAX gene-associated protein
MGA
1,174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTN2H3BTN2_HUMAN
MAX gene-associated protein
MGA
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X194A0A087X194_HUMAN
MAX gene-associated protein
MGA
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14186 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti266K → N in BAB14186 (PubMed:14702039).Curated1
Sequence conflicti742S → R in BAB14186 (PubMed:14702039).Curated1
Sequence conflicti1138R → K in AAH38449 (PubMed:15489334).Curated1
Sequence conflicti2191Missing in BAB14543 (PubMed:14702039).Curated1
Sequence conflicti2326A → T in BAB14543 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_044341338T → A. Corresponds to variant dbSNP:rs3803348Ensembl.1
Natural variantiVAR_044342716T → S. Corresponds to variant dbSNP:rs2178004Ensembl.1
Natural variantiVAR_0443431270C → R. Corresponds to variant dbSNP:rs17677811Ensembl.1
Natural variantiVAR_0572681523P → A. Corresponds to variant dbSNP:rs17677991Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0345341 – 1790Missing in isoform 2. 1 PublicationAdd BLAST1790
Alternative sequenceiVSP_0476691529 – 1763AARPS…GPRLL → ENAAQIPVATPQVSPNTVKR AGPRLLLIPVQQGSPTLRPV SNTQLQGHRMVLQPVRSPSG MNLFR in isoform 3. CuratedAdd BLAST235
Alternative sequenceiVSP_0476701763L → LLIPVQQGSPTLRPVSNTQL QGHRMVLQPVRSPSGMNLFR in isoform 4. Curated1
Alternative sequenceiVSP_0345352488 – 3026Missing in isoform 2. 1 PublicationAdd BLAST539

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK022696 mRNA Translation: BAB14186.1 Different initiation.
AK023360 mRNA Translation: BAB14543.1
AC016134 Genomic DNA No translation available.
AC073657 Genomic DNA No translation available.
BC038449 mRNA Translation: AAH38449.1
AB011090 mRNA Translation: BAA25444.1
AL050181 mRNA Translation: CAB43310.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55959.1 [Q8IWI9-4]
CCDS55960.1 [Q8IWI9-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00081

NCBI Reference Sequences

More...
RefSeqi
NP_001074010.2, NM_001080541.2 [Q8IWI9-3]
NP_001157745.1, NM_001164273.1 [Q8IWI9-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.187569

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000219905; ENSP00000219905; ENSG00000174197 [Q8IWI9-4]
ENST00000545763; ENSP00000442467; ENSG00000174197 [Q8IWI9-3]
ENST00000566586; ENSP00000456141; ENSG00000174197 [Q8IWI9-3]
ENST00000570161; ENSP00000457035; ENSG00000174197 [Q8IWI9-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23269

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23269

UCSC genome browser

More...
UCSCi
uc010ucy.2 human [Q8IWI9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022696 mRNA Translation: BAB14186.1 Different initiation.
AK023360 mRNA Translation: BAB14543.1
AC016134 Genomic DNA No translation available.
AC073657 Genomic DNA No translation available.
BC038449 mRNA Translation: AAH38449.1
AB011090 mRNA Translation: BAA25444.1
AL050181 mRNA Translation: CAB43310.1
CCDSiCCDS55959.1 [Q8IWI9-4]
CCDS55960.1 [Q8IWI9-3]
PIRiT00081
RefSeqiNP_001074010.2, NM_001080541.2 [Q8IWI9-3]
NP_001157745.1, NM_001164273.1 [Q8IWI9-4]
UniGeneiHs.187569

3D structure databases

ProteinModelPortaliQ8IWI9
SMRiQ8IWI9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116870, 66 interactors
CORUMiQ8IWI9
DIPiDIP-57615N
ELMiQ8IWI9
IntActiQ8IWI9, 48 interactors
MINTiQ8IWI9
STRINGi9606.ENSP00000219905

PTM databases

CarbonylDBiQ8IWI9
iPTMnetiQ8IWI9
PhosphoSitePlusiQ8IWI9

Polymorphism and mutation databases

BioMutaiMGA
DMDMi527504082

Proteomic databases

EPDiQ8IWI9
MaxQBiQ8IWI9
PaxDbiQ8IWI9
PeptideAtlasiQ8IWI9
PRIDEiQ8IWI9
ProteomicsDBi70860
70861 [Q8IWI9-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000219905; ENSP00000219905; ENSG00000174197 [Q8IWI9-4]
ENST00000545763; ENSP00000442467; ENSG00000174197 [Q8IWI9-3]
ENST00000566586; ENSP00000456141; ENSG00000174197 [Q8IWI9-3]
ENST00000570161; ENSP00000457035; ENSG00000174197 [Q8IWI9-4]
GeneIDi23269
KEGGihsa:23269
UCSCiuc010ucy.2 human [Q8IWI9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23269
DisGeNETi23269
EuPathDBiHostDB:ENSG00000174197.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MGA

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0012158
HGNCiHGNC:14010 MGA
HPAiHPA042278
HPA058183
MIMi616061 gene
neXtProtiNX_Q8IWI9
OpenTargetsiENSG00000174197
PharmGKBiPA134976336

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3585 Eukaryota
ENOG410XSTS LUCA
GeneTreeiENSGT00940000156269
HOGENOMiHOG000113578
HOVERGENiHBG108131
InParanoidiQ8IWI9
OMAiMQEAQEF
OrthoDBiEOG091G0I8R
TreeFamiTF106341

Enzyme and pathway databases

ReactomeiR-HSA-8953750 Transcriptional Regulation by E2F6
SIGNORiQ8IWI9

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MGA human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23269

Protein Ontology

More...
PROi
PR:Q8IWI9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000174197 Expressed in 229 organ(s), highest expression level in corpus callosum
CleanExiHS_MGA
ExpressionAtlasiQ8IWI9 baseline and differential
GenevisibleiQ8IWI9 HS

Family and domain databases

CDDicd00083 HLH, 1 hit
cd00182 TBOX, 1 hit
Gene3Di2.60.40.820, 1 hit
4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR032060 DUF4801
IPR036638 HLH_DNA-bd_sf
IPR037935 MAX_gene-associated_protein
IPR008967 p53-like_TF_DNA-bd
IPR036960 T-box_sf
IPR001699 TF_T-box
IPR018186 TF_T-box_CS
PANTHERiPTHR11267 PTHR11267, 2 hits
PTHR11267:SF32 PTHR11267:SF32, 2 hits
PfamiView protein in Pfam
PF16059 DUF4801, 1 hit
PF00010 HLH, 1 hit
PF00907 T-box, 1 hit
PRINTSiPR00937 TBOX
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SM00425 TBOX, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
SSF49417 SSF49417, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit
PS01264 TBOX_2, 1 hit
PS50252 TBOX_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMGAP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IWI9
Secondary accession number(s): E7ENI0
, F5H7K2, Q9H8R3, Q9H9N7, Q9UG69, Q9Y4E9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 24, 2013
Last modified: December 5, 2018
This is version 141 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again