Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (29 Sep 2021)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Dynein axonemal intermediate chain 3

Gene

DNAI3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a negative regulator of cell migration, invasion, and metastasis downstream of p53/TP53, through inhibition of Arp2/3 complex-mediated actin polymerization (PubMed:32128961).

Via its association with the multisubunit axonemal dynein complex, is potentially involved in the regulation of cilia function (By similarity).

May play a role in osteogenesis of dental tissue-derived mesenchymal stem cells (By similarity).

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q8IWG1

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q8IWG1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dynein axonemal intermediate chain 3Curated
Alternative name(s):
Testis development protein NYD-SP29
WD repeat-containing protein 63
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DNAI3Imported
Synonyms:WDR63
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30711, DNAI3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617968, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IWG1

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000162643

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A rare heterozygous in-frame DNAI3 deletion encompassing exons 14-17 has been found in a fetus with encephalocele. Overexpression of human DNAI3 RNA lacking exons 14-17 in zebrafish embryos also results in similar brain malformations, suggesting that DNAI3 defects might be involved in encephalocele formation.1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
126820

Open Targets

More...
OpenTargetsi
ENSG00000162643

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670596

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q8IWG1, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WDR63

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74759634

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002331621 – 891Dynein axonemal intermediate chain 3Add BLAST891

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q8IWG1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IWG1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IWG1

PeptideAtlas

More...
PeptideAtlasi
Q8IWG1

PRoteomics IDEntifications database

More...
PRIDEi
Q8IWG1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
70858 [Q8IWG1-1]
70859 [Q8IWG1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IWG1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IWG1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated at the transcriptional level by TP53.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162643, Expressed in testis and 117 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IWG1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IWG1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000162643, Tissue enhanced (adrenal gland, brain, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ACTR2; this interaction reduces binding of the Arp2/3 complex to the VCA domain of nucleation promoting factors (PubMed:32128961). Part of the multisubunit axonemal dynein complex formed at least of two heavy chains and a number of intermediate and light chains.

Found in a associated with the catalytic heavy chain DNAH2, the intermediate chain DNAI4, and the light chain DYNLT1 (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126018, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000294664

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8IWG1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati395 – 435WD 1Sequence analysisAdd BLAST41
Repeati477 – 533WD 2Sequence analysisAdd BLAST57
Repeati670 – 709WD 3Sequence analysisAdd BLAST40
Repeati713 – 753WD 4Sequence analysisAdd BLAST41

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 22DisorderedSequence analysisAdd BLAST22

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili818 – 861Sequence analysisAdd BLAST44

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 15Basic residuesSequence analysisAdd BLAST15

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1587, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156924

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009390_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IWG1

Identification of Orthologs from Complete Genome Data

More...
OMAi
EFICFAN

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IWG1

TreeFam database of animal gene trees

More...
TreeFami
TF326991

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR036322, WD40_repeat_dom_sf

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320, WD40, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978, SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678, WD_REPEATS_1, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IWG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPKQKKKTS RGKKRLKPVL AASEDMEPVN MESMGHPEIY PLVLTTKTQE
60 70 80 90 100
IFNCRIDEDV TDEQPYKLIN KEDIFEDLRN RAAVSDFHPV KKIVQEYPGN
110 120 130 140 150
ELLLVYDKDF KYGLNFYLIA TEEGKENYLN PPEVPEEQEE YKEHIPEDVY
160 170 180 190 200
IYKPPVSKPW VSLGSEKEIE EESVTESTKQ ITYMISRKRS EFGAPIKFSD
210 220 230 240 250
QNASSVKDAY IECTAYPDKN FTLKQLEKDV GMQVIPQIKD ISTQTKWTYP
260 270 280 290 300
KNATTQYYPR EFSEEEKETL KQSKPLVDFL NNASISVEIA LQQNEIMNTF
310 320 330 340 350
IDDWKYLAEE EGTFGDKTDT HLKEYQSFTD LHSPTEKMIT CVSWHPTIYG
360 370 380 390 400
LIAVSVAVRL SFEDRVHFSG KLLLQPSLIL FWSFSDPIHP QLMLESPDDI
410 420 430 440 450
FCFKFCPSDP NIIAGGCING QIVMWDITAH ADRIENIKAG GSRSKRATLK
460 470 480 490 500
PMFLLEPESN KEAMYIRHCA VSSIENGHKK VITDIHWLSD TFEINRMGSV
510 520 530 540 550
FENRSGICCQ LVTCSADCTI CFWDIRPQKP LTPQTTEKKK EESIEIPFDV
560 570 580 590 600
PSTFLHLDLS WKPLTKVRLS KGETSLDHCP TKISLNEDHL LCKTQDKMLA
610 620 630 640 650
QSKTEKAEEM NPYHNLESGM ANLLKPIDDF CTKFFVGTEE GEVIYTDWKM
660 670 680 690 700
EKDPETGRLM SKKPVSHHTI HDGTVHTIQR SPFYNDIILT VGGWNVAIWK
710 720 730 740 750
EGVMTGPLLQ SCCAPKRYTS GHWSLTRPGV FYIGREDGYI DIWDLLEKTH
760 770 780 790 800
EPAQSQNICI TMITYIKPWI FSSKQQFIAT ADYYGTLHIL EIPWTLSRPS
810 820 830 840 850
TNEMASVNHY FEREVKHLEY VEQRKKIREQ EKKEMELEMA KKKVKTYQKS
860 870 880 890
KEQMQAELKM DYESYLELEK TVLINLGLIK VTEKGSYMEV M
Length:891
Mass (Da):102,935
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i982EA7B814BCC1F1
GO
Isoform 2 (identifier: Q8IWG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-286: WTYPKNATTQYYPREFSEEEKETLKQSKPLVDFLNNASIS → C

Show »
Length:852
Mass (Da):98,301
Checksum:iAC62D7D6F05AE2E0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PLK2E9PLK2_HUMAN
Dynein axonemal intermediate chain ...
DNAI3
368Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEC9H0YEC9_HUMAN
Dynein axonemal intermediate chain ...
DNAI3
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PLW4E9PLW4_HUMAN
Dynein axonemal intermediate chain ...
DNAI3
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti108K → E in AAL06239 (Ref. 1) Curated1
Sequence conflicti441G → D in AAL06239 (Ref. 1) Curated1
Sequence conflicti496R → G in AAL06239 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057630674T → A. Corresponds to variant dbSNP:rs17121745Ensembl.1
Natural variantiVAR_057631798R → H. Corresponds to variant dbSNP:rs709783Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018080247 – 286WTYPK…NASIS → C in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY049724 mRNA Translation: AAL06239.1
AK054629 mRNA Translation: BAB70778.1
AK292603 mRNA Translation: BAF85292.1
AL358789 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73212.1
BC040265 mRNA Translation: AAH40265.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS702.1 [Q8IWG1-1]
CCDS72818.1 [Q8IWG1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001275492.1, NM_001288563.1 [Q8IWG1-2]
NP_660155.2, NM_145172.4 [Q8IWG1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000294664; ENSP00000294664; ENSG00000162643 [Q8IWG1-1]
ENST00000326813; ENSP00000317463; ENSG00000162643 [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643 [Q8IWG1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
126820

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:126820

UCSC genome browser

More...
UCSCi
uc001dkt.5, human [Q8IWG1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY049724 mRNA Translation: AAL06239.1
AK054629 mRNA Translation: BAB70778.1
AK292603 mRNA Translation: BAF85292.1
AL358789 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW73212.1
BC040265 mRNA Translation: AAH40265.1
CCDSiCCDS702.1 [Q8IWG1-1]
CCDS72818.1 [Q8IWG1-2]
RefSeqiNP_001275492.1, NM_001288563.1 [Q8IWG1-2]
NP_660155.2, NM_145172.4 [Q8IWG1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi126018, 1 interactor
STRINGi9606.ENSP00000294664

PTM databases

iPTMnetiQ8IWG1
PhosphoSitePlusiQ8IWG1

Genetic variation databases

BioMutaiWDR63
DMDMi74759634

Proteomic databases

MassIVEiQ8IWG1
MaxQBiQ8IWG1
PaxDbiQ8IWG1
PeptideAtlasiQ8IWG1
PRIDEiQ8IWG1
ProteomicsDBi70858 [Q8IWG1-1]
70859 [Q8IWG1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33558, 30 antibodies

The DNASU plasmid repository

More...
DNASUi
126820

Genome annotation databases

EnsembliENST00000294664; ENSP00000294664; ENSG00000162643 [Q8IWG1-1]
ENST00000326813; ENSP00000317463; ENSG00000162643 [Q8IWG1-2]
ENST00000370596; ENSP00000359628; ENSG00000162643 [Q8IWG1-2]
GeneIDi126820
KEGGihsa:126820
UCSCiuc001dkt.5, human [Q8IWG1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
126820
DisGeNETi126820

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DNAI3
HGNCiHGNC:30711, DNAI3
HPAiENSG00000162643, Tissue enhanced (adrenal gland, brain, testis)
MIMi617968, gene
neXtProtiNX_Q8IWG1
OpenTargetsiENSG00000162643
PharmGKBiPA142670596
VEuPathDBiHostDB:ENSG00000162643

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1587, Eukaryota
GeneTreeiENSGT00940000156924
HOGENOMiCLU_009390_1_0_1
InParanoidiQ8IWG1
OMAiEFICFAN
PhylomeDBiQ8IWG1
TreeFamiTF326991

Enzyme and pathway databases

PathwayCommonsiQ8IWG1
SignaLinkiQ8IWG1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
126820, 8 hits in 1003 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
126820
PharosiQ8IWG1, Tdark

Protein Ontology

More...
PROi
PR:Q8IWG1
RNActiQ8IWG1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000162643, Expressed in testis and 117 other tissues
ExpressionAtlasiQ8IWG1, baseline and differential
GenevisibleiQ8IWG1, HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR036322, WD40_repeat_dom_sf
SMARTiView protein in SMART
SM00320, WD40, 3 hits
SUPFAMiSSF50978, SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678, WD_REPEATS_1, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDNAI3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IWG1
Secondary accession number(s): A8K988, Q96L72, Q96NU4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2003
Last modified: September 29, 2021
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again