Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAP7 domain-containing protein 3

Gene

MAP7D3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Promotes the assembly and stability of microtubules.2 Publications

GO - Molecular functioni

  • microtubule binding Source: UniProtKB
  • tubulin binding Source: UniProtKB

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
MAP7 domain-containing protein 3
Gene namesi
Name:MAP7D3
Synonyms:MDP31 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000129680.15
HGNCiHGNC:25742 MAP7D3
MIMi300930 gene
neXtProtiNX_Q8IWC1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000129680
PharmGKBiPA162394972

Polymorphism and mutation databases

BioMutaiMAP7D3
DMDMi158705880

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003068121 – 876MAP7 domain-containing protein 3Add BLAST876

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei185PhosphoserineCombined sources1
Modified residuei322PhosphoserineCombined sources1
Modified residuei441PhosphoserineCombined sources1
Modified residuei457PhosphoserineCombined sources1
Modified residuei461PhosphoserineCombined sources1
Modified residuei490PhosphoserineCombined sources1
Modified residuei524PhosphoserineCombined sources1
Modified residuei770PhosphoserineCombined sources1
Modified residuei817PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8IWC1
MaxQBiQ8IWC1
PaxDbiQ8IWC1
PeptideAtlasiQ8IWC1
PRIDEiQ8IWC1
ProteomicsDBi70842
70843 [Q8IWC1-2]
70844 [Q8IWC1-3]

PTM databases

iPTMnetiQ8IWC1
PhosphoSitePlusiQ8IWC1

Expressioni

Inductioni

Expression is cell cycle dependent with the highest levels during G1, S, and M phases, and low level in G2 phase.1 Publication

Gene expression databases

BgeeiENSG00000129680 Expressed in 158 organ(s), highest expression level in testis
CleanExiHS_MAP7D3
ExpressionAtlasiQ8IWC1 baseline and differential
GenevisibleiQ8IWC1 HS

Organism-specific databases

HPAiHPA035598
HPA058101

Interactioni

Subunit structurei

Interacts (via N-terminus coiled coil domains) with tubulin and microtubules.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122777, 39 interactors
IntActiQ8IWC1, 31 interactors
MINTiQ8IWC1
STRINGi9606.ENSP00000318086

Structurei

3D structure databases

ProteinModelPortaliQ8IWC1
SMRiQ8IWC1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili65 – 144Sequence analysisAdd BLAST80
Coiled coili558 – 640Sequence analysisAdd BLAST83
Coiled coili689 – 724Sequence analysisAdd BLAST36

Sequence similaritiesi

Belongs to the MAP7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IIZ9 Eukaryota
ENOG410YMWJ LUCA
GeneTreeiENSGT00660000095160
HOVERGENiHBG103577
InParanoidiQ8IWC1
KOiK16807
OMAiKSPDTFR
OrthoDBiEOG091G05LZ
PhylomeDBiQ8IWC1
TreeFamiTF332273

Family and domain databases

InterProiView protein in InterPro
IPR008604 MAP7_fam
PANTHERiPTHR15073 PTHR15073, 1 hit
PfamiView protein in Pfam
PF05672 MAP7, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IWC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMADGAAAGA GGSPSLRELR ARMVAAANEI AKERRKQDVV NRVATHSSNI
60 70 80 90 100
RSTFKPVIDG SMLKNDIKQR LARERREEKR RQQDANKETQ LLEKERKTKL
110 120 130 140 150
QYEKQMEERQ RKLKERKEKE EQRRIAAEEK RHQKDEAQKE KFTAILYRTL
160 170 180 190 200
ERRRLADDYQ QKRWSWGGSA MANSESKTAN KRSASTEKLE QGTSALIRQM
210 220 230 240 250
PLSSAGLQNS VAKRKTDKER SSSLNRRDSN LHSSTDKEQA ERKPRVTGVT
260 270 280 290 300
NYVMQYVTVP LRKCTSDELR AVMFPMSTMK IPPQTKVEES PLEKVETPPK
310 320 330 340 350
ASVDAPPQVN VEVFCNTSME ASPKAGVGMA PEVSTDSFPV VSVDVSPVVS
360 370 380 390 400
TYDSEMSMDA SPELSIEALP KVDLETVPKV SIVASPEASL EAPPEVSLEA
410 420 430 440 450
LPEVSVEAAP EGSLEAPPKG SAEVAPKESV KGSPKESMEA SPEAMVKASP
460 470 480 490 500
KTSLEASMEA SPKAKARDAP KKSEMDKQAL IPIAKKRLSS YTECYKWSSS
510 520 530 540 550
PENACGLPSP ISTNRQIQKN CPPSPLPLIS KQSPQTSFPY KIMPIQHTLS
560 570 580 590 600
VQSASSTVKK KKETVSKTTN RCEALSQRHM IYEESGNKST AGIMNAEAAT
610 620 630 640 650
KILTELRRLA REQREKEEEE RQREEMQQRV IKKSKDMAKE AVGGQAEDHL
660 670 680 690 700
KLKDGQQQNE TKKKKGWLDQ EDQEAPLQKG DAKIKAQEEA DKRKKEHERI
710 720 730 740 750
MLQNLQERLE RKKRIEEIMK RTRKTDVNAS KVTETSSHDI YEEAEADNEE
760 770 780 790 800
SDKDSLNEMF PSAILNGTGS PTKFKMPFNN AKKMTHKLVF LEDGTSQVRK
810 820 830 840 850
EPKTYFNGDL KNFRQKSMKD TSIQEVVSRP SSKRMTSHTT KTRKADETNT
860 870
TSRSSAQTKS EGFHDILPKS SDTFRQ
Length:876
Mass (Da):98,429
Last modified:October 2, 2007 - v2
Checksum:iC149899FB0002B39
GO
Isoform 2 (identifier: Q8IWC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-286: Missing.

Note: No experimental confirmation available.
Show »
Length:835
Mass (Da):93,785
Checksum:i636105ADE4362780
GO
Isoform 3 (identifier: Q8IWC1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     179-214: ANKRSASTEKLEQGTSALIRQMPLSSAGLQNSVAKR → G

Note: No experimental confirmation available.
Show »
Length:841
Mass (Da):94,675
Checksum:i991CB99A9EA667C2
GO
Isoform 4 (identifier: Q8IWC1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: MMADGAAAGAGGSPSLRELRARM → MTSPR

Note: No experimental confirmation available.
Show »
Length:858
Mass (Da):96,743
Checksum:i46B3C99CFE457147
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRP0A0A0A0MRP0_HUMAN
MAP7 domain-containing protein 3
MAP7D3
802Annotation score:

Sequence cautioni

The sequence AAH64350 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti71L → S in BAG62994 (PubMed:14702039).Curated1
Sequence conflicti447K → R in BAG62994 (PubMed:14702039).Curated1
Sequence conflicti448A → T in AAH40518 (PubMed:15489334).Curated1
Sequence conflicti623R → Q in AL832120 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035314502E → A1 PublicationCorresponds to variant dbSNP:rs1055497Ensembl.1
Natural variantiVAR_077003561K → R1 PublicationCorresponds to variant dbSNP:rs748582851Ensembl.1
Natural variantiVAR_035315628Q → R1 PublicationCorresponds to variant dbSNP:rs2273221Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0450081 – 23MMADG…LRARM → MTSPR in isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_028498179 – 214ANKRS…SVAKR → G in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_028499246 – 286Missing in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022711 mRNA Translation: BAB14195.1
AK301478 mRNA Translation: BAG62994.1
AL832120 mRNA No translation available.
AL078638 Genomic DNA No translation available.
CH471150 Genomic DNA Translation: EAW88475.1
BC040518 mRNA Translation: AAH40518.1
BC064350 mRNA Translation: AAH64350.1 Sequence problems.
CCDSiCCDS44004.1 [Q8IWC1-1]
CCDS55508.1 [Q8IWC1-3]
CCDS55509.1 [Q8IWC1-4]
RefSeqiNP_001166987.1, NM_001173516.1 [Q8IWC1-4]
NP_001166988.1, NM_001173517.1 [Q8IWC1-3]
NP_078873.2, NM_024597.3 [Q8IWC1-1]
UniGeneiHs.446275

Genome annotation databases

EnsembliENST00000316077; ENSP00000318086; ENSG00000129680 [Q8IWC1-1]
ENST00000370661; ENSP00000359695; ENSG00000129680 [Q8IWC1-3]
ENST00000370663; ENSP00000359697; ENSG00000129680 [Q8IWC1-4]
GeneIDi79649
KEGGihsa:79649
UCSCiuc004ezs.4 human [Q8IWC1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022711 mRNA Translation: BAB14195.1
AK301478 mRNA Translation: BAG62994.1
AL832120 mRNA No translation available.
AL078638 Genomic DNA No translation available.
CH471150 Genomic DNA Translation: EAW88475.1
BC040518 mRNA Translation: AAH40518.1
BC064350 mRNA Translation: AAH64350.1 Sequence problems.
CCDSiCCDS44004.1 [Q8IWC1-1]
CCDS55508.1 [Q8IWC1-3]
CCDS55509.1 [Q8IWC1-4]
RefSeqiNP_001166987.1, NM_001173516.1 [Q8IWC1-4]
NP_001166988.1, NM_001173517.1 [Q8IWC1-3]
NP_078873.2, NM_024597.3 [Q8IWC1-1]
UniGeneiHs.446275

3D structure databases

ProteinModelPortaliQ8IWC1
SMRiQ8IWC1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122777, 39 interactors
IntActiQ8IWC1, 31 interactors
MINTiQ8IWC1
STRINGi9606.ENSP00000318086

PTM databases

iPTMnetiQ8IWC1
PhosphoSitePlusiQ8IWC1

Polymorphism and mutation databases

BioMutaiMAP7D3
DMDMi158705880

Proteomic databases

EPDiQ8IWC1
MaxQBiQ8IWC1
PaxDbiQ8IWC1
PeptideAtlasiQ8IWC1
PRIDEiQ8IWC1
ProteomicsDBi70842
70843 [Q8IWC1-2]
70844 [Q8IWC1-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316077; ENSP00000318086; ENSG00000129680 [Q8IWC1-1]
ENST00000370661; ENSP00000359695; ENSG00000129680 [Q8IWC1-3]
ENST00000370663; ENSP00000359697; ENSG00000129680 [Q8IWC1-4]
GeneIDi79649
KEGGihsa:79649
UCSCiuc004ezs.4 human [Q8IWC1-1]

Organism-specific databases

CTDi79649
EuPathDBiHostDB:ENSG00000129680.15
GeneCardsiMAP7D3
H-InvDBiHIX0017079
HGNCiHGNC:25742 MAP7D3
HPAiHPA035598
HPA058101
MIMi300930 gene
neXtProtiNX_Q8IWC1
OpenTargetsiENSG00000129680
PharmGKBiPA162394972
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IIZ9 Eukaryota
ENOG410YMWJ LUCA
GeneTreeiENSGT00660000095160
HOVERGENiHBG103577
InParanoidiQ8IWC1
KOiK16807
OMAiKSPDTFR
OrthoDBiEOG091G05LZ
PhylomeDBiQ8IWC1
TreeFamiTF332273

Miscellaneous databases

ChiTaRSiMAP7D3 human
GenomeRNAii79649
PROiPR:Q8IWC1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129680 Expressed in 158 organ(s), highest expression level in testis
CleanExiHS_MAP7D3
ExpressionAtlasiQ8IWC1 baseline and differential
GenevisibleiQ8IWC1 HS

Family and domain databases

InterProiView protein in InterPro
IPR008604 MAP7_fam
PANTHERiPTHR15073 PTHR15073, 1 hit
PfamiView protein in Pfam
PF05672 MAP7, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMA7D3_HUMAN
AccessioniPrimary (citable) accession number: Q8IWC1
Secondary accession number(s): A2A2J0
, A6NCZ7, A6NHR4, B4DWD2, H7BY77, Q5JXI5, Q5JXI6, Q6P2S1, Q9H9M8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: October 2, 2007
Last modified: November 7, 2018
This is version 123 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again