Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (08 May 2019)
Sequence version 3 (02 Nov 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Choline transporter-like protein 2

Gene

SLC44A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 1, but not isoform 3, exhibits some choline transporter activity.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1483191 Synthesis of PC
R-HSA-425366 Transport of bile salts and organic acids, metal ions and amine compounds
R-HSA-6798695 Neutrophil degranulation

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.92.1.4 the choline transporter-like (ctl) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Choline transporter-like protein 2
Alternative name(s):
Solute carrier family 44 member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC44A2
Synonyms:CTL2
ORF Names:PSEC0210
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17292 SLC44A2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606106 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IWA5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 33CytoplasmicSequence analysisAdd BLAST33
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei34 – 54HelicalSequence analysisAdd BLAST21
Topological domaini55 – 232ExtracellularSequence analysisAdd BLAST178
Transmembranei233 – 253HelicalSequence analysisAdd BLAST21
Topological domaini254 – 256CytoplasmicSequence analysis3
Transmembranei257 – 277HelicalSequence analysisAdd BLAST21
Topological domaini278 – 315ExtracellularSequence analysisAdd BLAST38
Transmembranei316 – 336HelicalSequence analysisAdd BLAST21
Topological domaini337 – 364CytoplasmicSequence analysisAdd BLAST28
Transmembranei365 – 385HelicalSequence analysisAdd BLAST21
Topological domaini386 – 457ExtracellularSequence analysisAdd BLAST72
Transmembranei458 – 480HelicalSequence analysisAdd BLAST23
Topological domaini481 – 504CytoplasmicSequence analysisAdd BLAST24
Transmembranei505 – 525HelicalSequence analysisAdd BLAST21
Topological domaini526 – 563ExtracellularSequence analysisAdd BLAST38
Transmembranei564 – 584HelicalSequence analysisAdd BLAST21
Topological domaini585 – 599CytoplasmicSequence analysisAdd BLAST15
Transmembranei600 – 620HelicalSequence analysisAdd BLAST21
Topological domaini621 – 638ExtracellularSequence analysisAdd BLAST18
Transmembranei639 – 659HelicalSequence analysisAdd BLAST21
Topological domaini660 – 706CytoplasmicSequence analysisAdd BLAST47

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57153

Open Targets

More...
OpenTargetsi
ENSG00000129353

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670899

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00122 Choline

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC44A2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033462

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001917171 – 706Choline transporter-like protein 2Add BLAST706

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei14PhosphothreonineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi187N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi200N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi417N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IWA5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IWA5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IWA5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IWA5

PeptideAtlas

More...
PeptideAtlasi
Q8IWA5

PRoteomics IDEntifications database

More...
PRIDEi
Q8IWA5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70829
70830 [Q8IWA5-2]
70831 [Q8IWA5-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1111

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IWA5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IWA5

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8IWA5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Present in supporting cells of the inner ear (at protein level). Only isoform 3 is expressed in inner ear vestibular tissue.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000129353 Expressed in 201 organ(s), highest expression level in placenta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IWA5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IWA5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003228
HPA070799

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with COCH.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121410, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q8IWA5, 3 interactors

Molecular INTeraction database

More...
MINTi
Q8IWA5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000336888

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IWA5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1362 Eukaryota
ENOG410XS0P LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158178

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IWA5

KEGG Orthology (KO)

More...
KOi
K15377

Identification of Orthologs from Complete Genome Data

More...
OMAi
CEGPAIN

Database of Orthologous Groups

More...
OrthoDBi
329225at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IWA5

TreeFam database of animal gene trees

More...
TreeFami
TF313325

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007603 Choline_transptr-like

The PANTHER Classification System

More...
PANTHERi
PTHR12385 PTHR12385, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04515 Choline_transpo, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IWA5-1) [UniParc]FASTAAdd to basket
Also known as: CTL2a, CTL2P2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDERPHYYG KHGTPQKYDP TFKGPIYNRG CTDIICCVFL LLAIVGYVAV
60 70 80 90 100
GIIAWTHGDP RKVIYPTDSR GEFCGQKGTK NENKPYLFYF NIVKCASPLV
110 120 130 140 150
LLEFQCPTPQ ICVEKCPDRY LTYLNARSSR DFEYYKQFCV PGFKNNKGVA
160 170 180 190 200
EVLQDGDCPA VLIPSKPLAR RCFPAIHAYK GVLMVGNETT YEDGHGSRKN
210 220 230 240 250
ITDLVEGAKK ANGVLEARQL AMRIFEDYTV SWYWIIIGLV IAMAMSLLFI
260 270 280 290 300
ILLRFLAGIM VWVMIIMVIL VLGYGIFHCY MEYSRLRGEA GSDVSLVDLG
310 320 330 340 350
FQTDFRVYLH LRQTWLAFMI ILSILEVIII LLLIFLRKRI LIAIALIKEA
360 370 380 390 400
SRAVGYVMCS LLYPLVTFFL LCLCIAYWAS TAVFLSTSNE AVYKIFDDSP
410 420 430 440 450
CPFTAKTCNP ETFPSSNESR QCPNARCQFA FYGGESGYHR ALLGLQIFNA
460 470 480 490 500
FMFFWLANFV LALGQVTLAG AFASYYWALR KPDDLPAFPL FSAFGRALRY
510 520 530 540 550
HTGSLAFGAL ILAIVQIIRV ILEYLDQRLK AAENKFAKCL MTCLKCCFWC
560 570 580 590 600
LEKFIKFLNR NAYIMIAIYG TNFCTSARNA FFLLMRNIIR VAVLDKVTDF
610 620 630 640 650
LFLLGKLLIV GSVGILAFFF FTHRIRIVQD TAPPLNYYWV PILTVIVGSY
660 670 680 690 700
LIAHGFFSVY GMCVDTLFLC FLEDLERNDG SAERPYFMSS TLKKLLNKTN

KKAAES
Length:706
Mass (Da):80,124
Last modified:November 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9A044A531930326E
GO
Isoform 2 (identifier: Q8IWA5-2) [UniParc]FASTAAdd to basket
Also known as: CTL2b, CTL2P2B

The sequence of this isoform differs from the canonical sequence as follows:
     672-706: LEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES → CEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE

Show »
Length:711
Mass (Da):80,737
Checksum:iFF8B042AFDEBA26C
GO
Isoform 3 (identifier: Q8IWA5-3) [UniParc]FASTAAdd to basket
Also known as: CTL2P1

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGDERPHYYGKH → MEDERKNGAY

Note: Produced by alternative promoter usage.
Show »
Length:704
Mass (Da):79,846
Checksum:i9B2CB6047E5FCDD6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ESP7K7ESP7_HUMAN
Choline transporter-like protein 2
SLC44A2
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMN3K7EMN3_HUMAN
Choline transporter-like protein 2
SLC44A2
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ER17K7ER17_HUMAN
Choline transporter-like protein 2
SLC44A2
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMR2K7EMR2_HUMAN
Choline transporter-like protein 2
SLC44A2
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESF5K7ESF5_HUMAN
Choline transporter-like protein 2
SLC44A2
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPV6K7EPV6_HUMAN
Choline transporter-like protein 2
SLC44A2
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TA83A0A140TA83_HUMAN
Choline transporter-like protein 2
SLC44A2
10Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC11662 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti92I → T in BAG51335 (PubMed:14702039).Curated1
Sequence conflicti153L → F in CBJ93592 (Ref. 3) Curated1
Sequence conflicti531A → G in CAB75542 (PubMed:10677542).Curated1
Sequence conflicti695L → P in AAH40556 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023404154Q → R6 PublicationsCorresponds to variant dbSNP:rs2288904Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0417921 – 12MGDER…YYGKH → MEDERKNGAY in isoform 3. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_015431672 – 706LEDLE…KAAES → CEDLERNDGSQERPYFMSPE LRDILLKGSAEEGKRAEAEE in isoform 2. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ245621 Genomic DNA Translation: CAB75542.1
FN668568 mRNA Translation: CBJ93592.1
AK027519 mRNA Translation: BAG51335.1
AK294118 mRNA Translation: BAG57451.1
AK314582 mRNA Translation: BAG37158.1
AC011475 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84126.1
BC010617 mRNA Translation: AAH10617.1
BC040556 mRNA Translation: AAH40556.1
AL832517 mRNA Translation: CAH56352.1
AL832978 mRNA Translation: CAH56342.1
AK075512 mRNA Translation: BAC11662.1 Different initiation.
AF070636 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12245.1 [Q8IWA5-1]
CCDS54216.1 [Q8IWA5-3]
CCDS86700.1 [Q8IWA5-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001138528.1, NM_001145056.1 [Q8IWA5-3]
NP_065161.3, NM_020428.3 [Q8IWA5-1]
XP_005260054.1, XM_005259997.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000335757; ENSP00000336888; ENSG00000129353 [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353 [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353 [Q8IWA5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57153

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57153

UCSC genome browser

More...
UCSCi
uc002mpe.5 human [Q8IWA5-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245621 Genomic DNA Translation: CAB75542.1
FN668568 mRNA Translation: CBJ93592.1
AK027519 mRNA Translation: BAG51335.1
AK294118 mRNA Translation: BAG57451.1
AK314582 mRNA Translation: BAG37158.1
AC011475 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84126.1
BC010617 mRNA Translation: AAH10617.1
BC040556 mRNA Translation: AAH40556.1
AL832517 mRNA Translation: CAH56352.1
AL832978 mRNA Translation: CAH56342.1
AK075512 mRNA Translation: BAC11662.1 Different initiation.
AF070636 mRNA No translation available.
CCDSiCCDS12245.1 [Q8IWA5-1]
CCDS54216.1 [Q8IWA5-3]
CCDS86700.1 [Q8IWA5-2]
RefSeqiNP_001138528.1, NM_001145056.1 [Q8IWA5-3]
NP_065161.3, NM_020428.3 [Q8IWA5-1]
XP_005260054.1, XM_005259997.1

3D structure databases

SMRiQ8IWA5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121410, 1 interactor
IntActiQ8IWA5, 3 interactors
MINTiQ8IWA5
STRINGi9606.ENSP00000336888

Chemistry databases

DrugBankiDB00122 Choline

Protein family/group databases

TCDBi2.A.92.1.4 the choline transporter-like (ctl) family

PTM databases

GlyConnecti1111
iPTMnetiQ8IWA5
PhosphoSitePlusiQ8IWA5
SwissPalmiQ8IWA5

Polymorphism and mutation databases

BioMutaiSLC44A2
DMDMi311033462

Proteomic databases

EPDiQ8IWA5
jPOSTiQ8IWA5
MaxQBiQ8IWA5
PaxDbiQ8IWA5
PeptideAtlasiQ8IWA5
PRIDEiQ8IWA5
ProteomicsDBi70829
70830 [Q8IWA5-2]
70831 [Q8IWA5-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335757; ENSP00000336888; ENSG00000129353 [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353 [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353 [Q8IWA5-2]
GeneIDi57153
KEGGihsa:57153
UCSCiuc002mpe.5 human [Q8IWA5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57153
DisGeNETi57153

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC44A2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0202740
HGNCiHGNC:17292 SLC44A2
HPAiHPA003228
HPA070799
MIMi606106 gene
neXtProtiNX_Q8IWA5
OpenTargetsiENSG00000129353
PharmGKBiPA142670899

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1362 Eukaryota
ENOG410XS0P LUCA
GeneTreeiENSGT00940000158178
InParanoidiQ8IWA5
KOiK15377
OMAiCEGPAIN
OrthoDBi329225at2759
PhylomeDBiQ8IWA5
TreeFamiTF313325

Enzyme and pathway databases

ReactomeiR-HSA-1483191 Synthesis of PC
R-HSA-425366 Transport of bile salts and organic acids, metal ions and amine compounds
R-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC44A2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC44A2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57153

Protein Ontology

More...
PROi
PR:Q8IWA5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000129353 Expressed in 201 organ(s), highest expression level in placenta
ExpressionAtlasiQ8IWA5 baseline and differential
GenevisibleiQ8IWA5 HS

Family and domain databases

InterProiView protein in InterPro
IPR007603 Choline_transptr-like
PANTHERiPTHR12385 PTHR12385, 1 hit
PfamiView protein in Pfam
PF04515 Choline_transpo, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCTL2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IWA5
Secondary accession number(s): B2RBB1
, B3KNH3, B4DFJ0, F2Q9D7, Q658V1, Q658Z2, Q6PJV7, Q8N2F0, Q9NY68
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: November 2, 2010
Last modified: May 8, 2019
This is version 140 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again