Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Choline transporter-like protein 2

Gene

SLC44A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1, but not isoform 3, exhibits some choline transporter activity.2 Publications

GO - Molecular functioni

  • choline transmembrane transporter activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processTransport

Enzyme and pathway databases

ReactomeiR-HSA-1483191 Synthesis of PC
R-HSA-425366 Transport of bile salts and organic acids, metal ions and amine compounds
R-HSA-6798695 Neutrophil degranulation

Protein family/group databases

TCDBi2.A.92.1.4 the choline transporter-like (ctl) family

Names & Taxonomyi

Protein namesi
Recommended name:
Choline transporter-like protein 2
Alternative name(s):
Solute carrier family 44 member 2
Gene namesi
Name:SLC44A2
Synonyms:CTL2
ORF Names:PSEC0210
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000129353.14
HGNCiHGNC:17292 SLC44A2
MIMi606106 gene
neXtProtiNX_Q8IWA5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 33CytoplasmicSequence analysisAdd BLAST33
Transmembranei34 – 54HelicalSequence analysisAdd BLAST21
Topological domaini55 – 232ExtracellularSequence analysisAdd BLAST178
Transmembranei233 – 253HelicalSequence analysisAdd BLAST21
Topological domaini254 – 256CytoplasmicSequence analysis3
Transmembranei257 – 277HelicalSequence analysisAdd BLAST21
Topological domaini278 – 315ExtracellularSequence analysisAdd BLAST38
Transmembranei316 – 336HelicalSequence analysisAdd BLAST21
Topological domaini337 – 364CytoplasmicSequence analysisAdd BLAST28
Transmembranei365 – 385HelicalSequence analysisAdd BLAST21
Topological domaini386 – 457ExtracellularSequence analysisAdd BLAST72
Transmembranei458 – 480HelicalSequence analysisAdd BLAST23
Topological domaini481 – 504CytoplasmicSequence analysisAdd BLAST24
Transmembranei505 – 525HelicalSequence analysisAdd BLAST21
Topological domaini526 – 563ExtracellularSequence analysisAdd BLAST38
Transmembranei564 – 584HelicalSequence analysisAdd BLAST21
Topological domaini585 – 599CytoplasmicSequence analysisAdd BLAST15
Transmembranei600 – 620HelicalSequence analysisAdd BLAST21
Topological domaini621 – 638ExtracellularSequence analysisAdd BLAST18
Transmembranei639 – 659HelicalSequence analysisAdd BLAST21
Topological domaini660 – 706CytoplasmicSequence analysisAdd BLAST47

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi57153
OpenTargetsiENSG00000129353
PharmGKBiPA142670899

Chemistry databases

DrugBankiDB00122 Choline

Polymorphism and mutation databases

BioMutaiSLC44A2
DMDMi311033462

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001917171 – 706Choline transporter-like protein 2Add BLAST706

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei14PhosphothreonineCombined sources1
Glycosylationi187N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi200N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi417N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ8IWA5
MaxQBiQ8IWA5
PaxDbiQ8IWA5
PeptideAtlasiQ8IWA5
PRIDEiQ8IWA5
ProteomicsDBi70829
70830 [Q8IWA5-2]
70831 [Q8IWA5-3]

PTM databases

GlyConnecti1111
iPTMnetiQ8IWA5
PhosphoSitePlusiQ8IWA5
SwissPalmiQ8IWA5

Expressioni

Tissue specificityi

Present in supporting cells of the inner ear (at protein level). Only isoform 3 is expressed in inner ear vestibular tissue.2 Publications

Gene expression databases

BgeeiENSG00000129353 Expressed in 201 organ(s), highest expression level in placenta
CleanExiHS_SLC44A2
ExpressionAtlasiQ8IWA5 baseline and differential
GenevisibleiQ8IWA5 HS

Organism-specific databases

HPAiHPA003228
HPA070799

Interactioni

Subunit structurei

Interacts with COCH.1 Publication

Protein-protein interaction databases

BioGridi121410, 1 interactor
IntActiQ8IWA5, 1 interactor
MINTiQ8IWA5
STRINGi9606.ENSP00000336888

Structurei

3D structure databases

ProteinModelPortaliQ8IWA5
SMRiQ8IWA5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1362 Eukaryota
ENOG410XS0P LUCA
GeneTreeiENSGT00550000074521
HOVERGENiHBG062155
InParanoidiQ8IWA5
KOiK15377
OMAiGAHCQFA
OrthoDBiEOG091G04CQ
PhylomeDBiQ8IWA5
TreeFamiTF313325

Family and domain databases

InterProiView protein in InterPro
IPR007603 Choline_transptr-like
PANTHERiPTHR12385 PTHR12385, 1 hit
PfamiView protein in Pfam
PF04515 Choline_transpo, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IWA5-1) [UniParc]FASTAAdd to basket
Also known as: CTL2a, CTL2P2A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDERPHYYG KHGTPQKYDP TFKGPIYNRG CTDIICCVFL LLAIVGYVAV
60 70 80 90 100
GIIAWTHGDP RKVIYPTDSR GEFCGQKGTK NENKPYLFYF NIVKCASPLV
110 120 130 140 150
LLEFQCPTPQ ICVEKCPDRY LTYLNARSSR DFEYYKQFCV PGFKNNKGVA
160 170 180 190 200
EVLQDGDCPA VLIPSKPLAR RCFPAIHAYK GVLMVGNETT YEDGHGSRKN
210 220 230 240 250
ITDLVEGAKK ANGVLEARQL AMRIFEDYTV SWYWIIIGLV IAMAMSLLFI
260 270 280 290 300
ILLRFLAGIM VWVMIIMVIL VLGYGIFHCY MEYSRLRGEA GSDVSLVDLG
310 320 330 340 350
FQTDFRVYLH LRQTWLAFMI ILSILEVIII LLLIFLRKRI LIAIALIKEA
360 370 380 390 400
SRAVGYVMCS LLYPLVTFFL LCLCIAYWAS TAVFLSTSNE AVYKIFDDSP
410 420 430 440 450
CPFTAKTCNP ETFPSSNESR QCPNARCQFA FYGGESGYHR ALLGLQIFNA
460 470 480 490 500
FMFFWLANFV LALGQVTLAG AFASYYWALR KPDDLPAFPL FSAFGRALRY
510 520 530 540 550
HTGSLAFGAL ILAIVQIIRV ILEYLDQRLK AAENKFAKCL MTCLKCCFWC
560 570 580 590 600
LEKFIKFLNR NAYIMIAIYG TNFCTSARNA FFLLMRNIIR VAVLDKVTDF
610 620 630 640 650
LFLLGKLLIV GSVGILAFFF FTHRIRIVQD TAPPLNYYWV PILTVIVGSY
660 670 680 690 700
LIAHGFFSVY GMCVDTLFLC FLEDLERNDG SAERPYFMSS TLKKLLNKTN

KKAAES
Length:706
Mass (Da):80,124
Last modified:November 2, 2010 - v3
Checksum:i9A044A531930326E
GO
Isoform 2 (identifier: Q8IWA5-2) [UniParc]FASTAAdd to basket
Also known as: CTL2b, CTL2P2B

The sequence of this isoform differs from the canonical sequence as follows:
     672-706: LEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES → CEDLERNDGSQERPYFMSPELRDILLKGSAEEGKRAEAEE

Show »
Length:711
Mass (Da):80,737
Checksum:iFF8B042AFDEBA26C
GO
Isoform 3 (identifier: Q8IWA5-3) [UniParc]FASTAAdd to basket
Also known as: CTL2P1

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MGDERPHYYGKH → MEDERKNGAY

Note: Produced by alternative promoter usage.
Show »
Length:704
Mass (Da):79,846
Checksum:i9B2CB6047E5FCDD6
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ESP7K7ESP7_HUMAN
Choline transporter-like protein 2
SLC44A2
148Annotation score:
K7ER17K7ER17_HUMAN
Choline transporter-like protein 2
SLC44A2
95Annotation score:
K7EMN3K7EMN3_HUMAN
Choline transporter-like protein 2
SLC44A2
124Annotation score:
K7ESF5K7ESF5_HUMAN
Choline transporter-like protein 2
SLC44A2
170Annotation score:
K7EPV6K7EPV6_HUMAN
Choline transporter-like protein 2
SLC44A2
146Annotation score:
K7EMR2K7EMR2_HUMAN
Choline transporter-like protein 2
SLC44A2
42Annotation score:
A0A140TA83A0A140TA83_HUMAN
Choline transporter-like protein 2
SLC44A2
10Annotation score:

Sequence cautioni

The sequence BAC11662 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti92I → T in BAG51335 (PubMed:14702039).Curated1
Sequence conflicti153L → F in CBJ93592 (Ref. 3) Curated1
Sequence conflicti531A → G in CAB75542 (PubMed:10677542).Curated1
Sequence conflicti695L → P in AAH40556 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_023404154Q → R6 PublicationsCorresponds to variant dbSNP:rs2288904Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0417921 – 12MGDER…YYGKH → MEDERKNGAY in isoform 3. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_015431672 – 706LEDLE…KAAES → CEDLERNDGSQERPYFMSPE LRDILLKGSAEEGKRAEAEE in isoform 2. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245621 Genomic DNA Translation: CAB75542.1
FN668568 mRNA Translation: CBJ93592.1
AK027519 mRNA Translation: BAG51335.1
AK294118 mRNA Translation: BAG57451.1
AK314582 mRNA Translation: BAG37158.1
AC011475 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84126.1
BC010617 mRNA Translation: AAH10617.1
BC040556 mRNA Translation: AAH40556.1
AL832517 mRNA Translation: CAH56352.1
AL832978 mRNA Translation: CAH56342.1
AK075512 mRNA Translation: BAC11662.1 Different initiation.
AF070636 mRNA No translation available.
CCDSiCCDS12245.1 [Q8IWA5-1]
CCDS54216.1 [Q8IWA5-3]
CCDS86700.1 [Q8IWA5-2]
RefSeqiNP_001138528.1, NM_001145056.1 [Q8IWA5-3]
NP_065161.3, NM_020428.3 [Q8IWA5-1]
XP_005260054.1, XM_005259997.1
UniGeneiHs.534560

Genome annotation databases

EnsembliENST00000335757; ENSP00000336888; ENSG00000129353 [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353 [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353 [Q8IWA5-2]
GeneIDi57153
KEGGihsa:57153
UCSCiuc002mpe.5 human [Q8IWA5-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245621 Genomic DNA Translation: CAB75542.1
FN668568 mRNA Translation: CBJ93592.1
AK027519 mRNA Translation: BAG51335.1
AK294118 mRNA Translation: BAG57451.1
AK314582 mRNA Translation: BAG37158.1
AC011475 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84126.1
BC010617 mRNA Translation: AAH10617.1
BC040556 mRNA Translation: AAH40556.1
AL832517 mRNA Translation: CAH56352.1
AL832978 mRNA Translation: CAH56342.1
AK075512 mRNA Translation: BAC11662.1 Different initiation.
AF070636 mRNA No translation available.
CCDSiCCDS12245.1 [Q8IWA5-1]
CCDS54216.1 [Q8IWA5-3]
CCDS86700.1 [Q8IWA5-2]
RefSeqiNP_001138528.1, NM_001145056.1 [Q8IWA5-3]
NP_065161.3, NM_020428.3 [Q8IWA5-1]
XP_005260054.1, XM_005259997.1
UniGeneiHs.534560

3D structure databases

ProteinModelPortaliQ8IWA5
SMRiQ8IWA5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121410, 1 interactor
IntActiQ8IWA5, 1 interactor
MINTiQ8IWA5
STRINGi9606.ENSP00000336888

Chemistry databases

DrugBankiDB00122 Choline

Protein family/group databases

TCDBi2.A.92.1.4 the choline transporter-like (ctl) family

PTM databases

GlyConnecti1111
iPTMnetiQ8IWA5
PhosphoSitePlusiQ8IWA5
SwissPalmiQ8IWA5

Polymorphism and mutation databases

BioMutaiSLC44A2
DMDMi311033462

Proteomic databases

EPDiQ8IWA5
MaxQBiQ8IWA5
PaxDbiQ8IWA5
PeptideAtlasiQ8IWA5
PRIDEiQ8IWA5
ProteomicsDBi70829
70830 [Q8IWA5-2]
70831 [Q8IWA5-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335757; ENSP00000336888; ENSG00000129353 [Q8IWA5-1]
ENST00000407327; ENSP00000385135; ENSG00000129353 [Q8IWA5-3]
ENST00000586078; ENSP00000466664; ENSG00000129353 [Q8IWA5-2]
GeneIDi57153
KEGGihsa:57153
UCSCiuc002mpe.5 human [Q8IWA5-1]

Organism-specific databases

CTDi57153
DisGeNETi57153
EuPathDBiHostDB:ENSG00000129353.14
GeneCardsiSLC44A2
H-InvDBiHIX0202740
HGNCiHGNC:17292 SLC44A2
HPAiHPA003228
HPA070799
MIMi606106 gene
neXtProtiNX_Q8IWA5
OpenTargetsiENSG00000129353
PharmGKBiPA142670899
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1362 Eukaryota
ENOG410XS0P LUCA
GeneTreeiENSGT00550000074521
HOVERGENiHBG062155
InParanoidiQ8IWA5
KOiK15377
OMAiGAHCQFA
OrthoDBiEOG091G04CQ
PhylomeDBiQ8IWA5
TreeFamiTF313325

Enzyme and pathway databases

ReactomeiR-HSA-1483191 Synthesis of PC
R-HSA-425366 Transport of bile salts and organic acids, metal ions and amine compounds
R-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

ChiTaRSiSLC44A2 human
GeneWikiiSLC44A2
GenomeRNAii57153
PROiPR:Q8IWA5
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129353 Expressed in 201 organ(s), highest expression level in placenta
CleanExiHS_SLC44A2
ExpressionAtlasiQ8IWA5 baseline and differential
GenevisibleiQ8IWA5 HS

Family and domain databases

InterProiView protein in InterPro
IPR007603 Choline_transptr-like
PANTHERiPTHR12385 PTHR12385, 1 hit
PfamiView protein in Pfam
PF04515 Choline_transpo, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCTL2_HUMAN
AccessioniPrimary (citable) accession number: Q8IWA5
Secondary accession number(s): B2RBB1
, B3KNH3, B4DFJ0, F2Q9D7, Q658V1, Q658Z2, Q6PJV7, Q8N2F0, Q9NY68
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: November 2, 2010
Last modified: November 7, 2018
This is version 136 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again