Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (08 May 2019)
Sequence version 4 (18 May 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

T-lymphoma invasion and metastasis-inducing protein 2

Gene

TIAM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP-dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane (By similarity). Activates specifically RAC1, but not CDC42 and RHOA.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-1989781 PPARA activates gene expression
R-HSA-416482 G alpha (12/13) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
T-lymphoma invasion and metastasis-inducing protein 2
Short name:
TIAM-2
Alternative name(s):
SIF and TIAM1-like exchange factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TIAM2
Synonyms:KIAA2016, STEF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11806 TIAM2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604709 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IVF5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
26230

Open Targets

More...
OpenTargetsi
ENSG00000146426

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36515

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TIAM2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296453025

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedSequence analysis
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003174672 – 1701T-lymphoma invasion and metastasis-inducing protein 2Add BLAST1700

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1583PhosphoserineBy similarity1
Modified residuei1648PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine and threonine residues. Phosphorylated on Thr-1648 by Rho-kinase. Its phosphorylation by Rho-kinase inhibits its guanine nucleotide exchange activity, its interaction with MAP1A, MAP1B, PARP1 and YWHAE and reduces its ability to promote neurite growth (By similarity).By similarity

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8IVF5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IVF5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IVF5

PeptideAtlas

More...
PeptideAtlasi
Q8IVF5

PRoteomics IDEntifications database

More...
PRIDEi
Q8IVF5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70693
70694 [Q8IVF5-2]
70695 [Q8IVF5-3]
70696 [Q8IVF5-4]
70697 [Q8IVF5-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IVF5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IVF5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the occipital, frontal and temporal lobes, cerebellum, putamen and testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000146426 Expressed in 186 organ(s), highest expression level in anterior cingulate cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IVF5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IVF5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA011134
HPA013903

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAP1A, MAP1B, PARP1 and YWHAE. Interacts with CD44, PARD3 and MAPK8IP2 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117621, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q8IVF5, 7 interactors

Molecular INTeraction database

More...
MINTi
Q8IVF5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000437188

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IVF5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini506 – 620PH 1PROSITE-ProRule annotationAdd BLAST115
Domaini810 – 881RBDPROSITE-ProRule annotationAdd BLAST72
Domaini890 – 976PDZPROSITE-ProRule annotationAdd BLAST87
Domaini1099 – 1293DHPROSITE-ProRule annotationAdd BLAST195
Domaini1347 – 1478PH 2PROSITE-ProRule annotationAdd BLAST132

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili628 – 695Sequence analysisAdd BLAST68

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH 1 domain and amino acids 621-782 (a region called TSS; otherwise known as CC-Ex) are necessary for membrane localization. The PH 1 and TSS domains are necessary for Rac1 activity. The PH 2 domain is engaged in the enhancement of the catalytic activity of the adjacent DH domain. The PH 1, TSS and DH domains are necessary to induce neurite-like structure (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TIAM family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410ITS1 Eukaryota
ENOG410XPCM LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157012

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IVF5

KEGG Orthology (KO)

More...
KOi
K16847

Identification of Orthologs from Complete Genome Data

More...
OMAi
ENGFHYV

Database of Orthologous Groups

More...
OrthoDBi
34437at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IVF5

TreeFam database of animal gene trees

More...
TreeFami
TF319686

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00160 RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit
2.30.29.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR001478 PDZ
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR003116 RBD_dom
IPR040655 TIAM1_CC-Ex

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF18385 Tiam_CC_Ex, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit
SM00233 PH, 2 hits
SM00455 RBD, 1 hit
SM00325 RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065 SSF48065, 1 hit
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50106 PDZ, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50898 RBD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IVF5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNSDSQYTL QGSKNHSNTI TGAKQIPCSL KIRGIHAKEE KSLHGWGHGS
60 70 80 90 100
NGAGYKSRSL ARSCLSHFKS NQPYASRLGG PTCKVSRGVA YSTHRTNAPG
110 120 130 140 150
KDFQGISAAF STENGFHSVG HELADNHITS RDCNGHLLNC YGRNESIAST
160 170 180 190 200
PPGEDRKSPR VLIKTLGKLD GCLRVEFHNG GNPSKVPAED CSEPVQLLRY
210 220 230 240 250
SPTLASETSP VPEARRGSSA DSLPSHRPSP TDSRLRSSKG SSLSSESSWY
260 270 280 290 300
DSPWGNAGEL SEAEGSFLAP GMPDPSLHAS FPPGDAKKPF NQSSSLSSLR
310 320 330 340 350
ELYKDANLGS LSPSGIRLSD EYMGTHASLS NRVSFASDID VPSRVAHGDP
360 370 380 390 400
IQYSSFTLPC RKPKAFVEDT AKKDSLKARM RRISDWTGSL SRKKRKLQEP
410 420 430 440 450
RSKEGSDYFD SRSDGLNTDV QGSSQASAFL WSGGSTQILS QRSESTHAIG
460 470 480 490 500
SDPLRQNIYE NFMRELEMSR TNTENIETST ETAESSSESL SSLEQLDLLF
510 520 530 540 550
EKEQGVVRKA GWLFFKPLVT VQKERKLELV ARRKWKQYWV TLKGCTLLFY
560 570 580 590 600
ETYGKNSMDQ SSAPRCALFA EDSIVQSVPE HPKKENVFCL SNSFGDVYLF
610 620 630 640 650
QATSQTDLEN WVTAVHSACA SLFAKKHGKE DTLRLLKNQT KNLLQKIDMD
660 670 680 690 700
SKMKKMAELQ LSVVSDPKNR KAIENQIQQW EQNLEKFHMD LFRMRCYLAS
710 720 730 740 750
LQGGELPNPK SLLAAASRPS KLALGRLGIL SVSSFHALVC SRDDSALRKR
760 770 780 790 800
TLSLTQRGRN KKGIFSSLKG LDTLARKGKE KRPSITQVDE LLHIYGSTVD
810 820 830 840 850
GVPRDNAWEI QTYVHFQDNH GVTVGIKPEH RVEDILTLAC KMRQLEPSHY
860 870 880 890 900
GLQLRKLVDD NVEYCIPAPY EYMQQQVYDE IEVFPLNVYD VQLTKTGSVC
910 920 930 940 950
DFGFAVTAQV DERQHLSRIF ISDVLPDGLA YGEGLRKGNE IMTLNGEAVS
960 970 980 990 1000
DLDLKQMEAL FSEKSVGLTL IARPPDTKAT LCTSWSDSDL FSRDQKSLLP
1010 1020 1030 1040 1050
PPNQSQLLEE FLDNFKKNTA NDFSNVPDIT TGLKRSQTDG TLDQVSHREK
1060 1070 1080 1090 1100
MEQTFRSAEQ ITALCRSFND SQANGMEGPR ENQDPPPRSL ARHLSDADRL
1110 1120 1130 1140 1150
RKVIQELVDT EKSYVKDLSC LFELYLEPLQ NETFLTQDEM ESLFGSLPEM
1160 1170 1180 1190 1200
LEFQKVFLET LEDGISASSD FNTLETPSQF RKLLFSLGGS FLYYADHFKL
1210 1220 1230 1240 1250
YSGFCANHIK VQKVLERAKT DKAFKAFLDA RNPTKQHSST LESYLIKPVQ
1260 1270 1280 1290 1300
RVLKYPLLLK ELVSLTDQES EEHYHLTEAL KAMEKVASHI NEMQKIYEDY
1310 1320 1330 1340 1350
GTVFDQLVAE QSGTEKEVTE LSMGELLMHS TVSWLNPFLS LGKARKDLEL
1360 1370 1380 1390 1400
TVFVFKRAVI LVYKENCKLK KKLPSNSRPA HNSTDLDPFK FRWLIPISAL
1410 1420 1430 1440 1450
QVRLGNPAGT ENNSIWELIH TKSEIEGRPE TIFQLCCSDS ESKTNIVKVI
1460 1470 1480 1490 1500
RSILRENFRR HIKCELPLEK TCKDRLVPLK NRVPVSAKLA SSRSLKVLKN
1510 1520 1530 1540 1550
SSSNEWTGET GKGTLLDSDE GSLSSGTQSS GCPTAEGRQD SKSTSPGKYP
1560 1570 1580 1590 1600
HPGLADFADN LIKESDILSD EDDDHRQTVK QGSPTKDIEI QFQRLRISED
1610 1620 1630 1640 1650
PDVHPEAEQQ PGPESGEGQK GGEQPKLVRG HFCPIKRKAN STKRDRGTLL
1660 1670 1680 1690 1700
KAQIRHQSLD SQSENATIDL NSVLEREFSV QSLTSVVSEE CFYETESHGK

S
Length:1,701
Mass (Da):190,103
Last modified:May 18, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC2C9C9B1782B7823
GO
Isoform 2 (identifier: Q8IVF5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1317-1317: E → EQPEWSSEVMDVLDPRGKLTKGTLEEPRTL

Show »
Length:1,730
Mass (Da):193,398
Checksum:i05CE6315772C1B90
GO
Isoform 3 (identifier: Q8IVF5-3) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1075: Missing.

Show »
Length:626
Mass (Da):70,774
Checksum:i782D90DF706BEC02
GO
Isoform 4 (identifier: Q8IVF5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-688: Missing.

Show »
Length:1,013
Mass (Da):114,079
Checksum:iD7C1B5D6B346E3D9
GO
Isoform 5 (identifier: Q8IVF5-5) [UniParc]FASTAAdd to basket
Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     787-787: Q → QIFDSSGSHGFSGTQLPQNSSNSSE

Show »
Length:1,725
Mass (Da):192,555
Checksum:iA836FE578E412A5C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PMZ8E9PMZ8_HUMAN
T-lymphoma invasion and metastasis-...
TIAM2
1,367Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKT1E9PKT1_HUMAN
T-lymphoma invasion and metastasis-...
TIAM2
1,045Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5V6H7C5V6_HUMAN
T-lymphoma invasion and metastasis-...
TIAM2
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1M3F5H1M3_HUMAN
T-lymphoma invasion and metastasis-...
TIAM2
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6W6F5H6W6_HUMAN
T-lymphoma invasion and metastasis-...
TIAM2
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6R0F5H6R0_HUMAN
T-lymphoma invasion and metastasis-...
TIAM2
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGV1H0YGV1_HUMAN
T-lymphoma invasion and metastasis-...
TIAM2
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF05900 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC23112 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC86170 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti506V → A in BAC86170 (PubMed:14702039).Curated1
Sequence conflicti633L → P in AAF05900 (PubMed:10512681).Curated1
Sequence conflicti722L → P in AAF05900 (PubMed:10512681).Curated1
Sequence conflicti807A → T in AAF05900 (PubMed:10512681).Curated1
Sequence conflicti1066R → K in BAC86170 (PubMed:14702039).Curated1
Sequence conflicti1092R → G in AAH66979 (PubMed:15489334).Curated1
Sequence conflicti1154Q → R in AAH66979 (PubMed:15489334).Curated1
Sequence conflicti1186S → P in BAC86170 (PubMed:14702039).Curated1
Sequence conflicti1306Q → R in BAC86170 (PubMed:14702039).Curated1
Sequence conflicti1365E → K in BAC86170 (PubMed:14702039).Curated1
Sequence conflicti1376N → Y in AAH66979 (PubMed:15489334).Curated1
Sequence conflicti1451R → S in AAH66979 (PubMed:15489334).Curated1
Sequence conflicti1482R → G in AAH66979 (PubMed:15489334).Curated1
Sequence conflicti1519D → Y in BAC86170 (PubMed:14702039).Curated1
Sequence conflicti1639A → T in BAC86170 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051994332R → H. Corresponds to variant dbSNP:rs931312Ensembl.1
Natural variantiVAR_051995913R → H. Corresponds to variant dbSNP:rs7770537Ensembl.1
Natural variantiVAR_0519961089S → P5 PublicationsCorresponds to variant dbSNP:rs4259257Ensembl.1
Natural variantiVAR_0385341101R → C. Corresponds to variant dbSNP:rs11751128Ensembl.1
Natural variantiVAR_0385351572D → E. Corresponds to variant dbSNP:rs1571767Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0309711 – 1075Missing in isoform 3. 2 PublicationsAdd BLAST1075
Alternative sequenceiVSP_0309721 – 688Missing in isoform 4. 1 PublicationAdd BLAST688
Alternative sequenceiVSP_030974787Q → QIFDSSGSHGFSGTQLPQNS SNSSE in isoform 5. 1 Publication1
Alternative sequenceiVSP_0309751317E → EQPEWSSEVMDVLDPRGKLT KGTLEEPRTL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF120323 mRNA Translation: AAF05900.1 Different initiation.
AF120324 mRNA Translation: AAF05901.1
AB095936 mRNA Translation: BAC23112.2 Different initiation.
AL122086 mRNA Translation: CAB59259.2
AL139101 Genomic DNA No translation available.
AL355343 Genomic DNA No translation available.
AL596202 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47693.1
BC066979 mRNA Translation: AAH66979.1
BC137275 mRNA Translation: AAI37276.1
AK125459 mRNA Translation: BAC86170.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34558.1 [Q8IVF5-1]
CCDS34559.1 [Q8IVF5-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001010927.1, NM_001010927.2
NP_036586.2, NM_012454.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000275246; ENSP00000275246; ENSG00000146426 [Q8IVF5-3]
ENST00000360366; ENSP00000353528; ENSG00000146426 [Q8IVF5-5]
ENST00000456877; ENSP00000407183; ENSG00000146426 [Q8IVF5-4]
ENST00000461783; ENSP00000437188; ENSG00000146426 [Q8IVF5-1]
ENST00000529824; ENSP00000433348; ENSG00000146426 [Q8IVF5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26230

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26230

UCSC genome browser

More...
UCSCi
uc003qqb.3 human [Q8IVF5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF120323 mRNA Translation: AAF05900.1 Different initiation.
AF120324 mRNA Translation: AAF05901.1
AB095936 mRNA Translation: BAC23112.2 Different initiation.
AL122086 mRNA Translation: CAB59259.2
AL139101 Genomic DNA No translation available.
AL355343 Genomic DNA No translation available.
AL596202 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47693.1
BC066979 mRNA Translation: AAH66979.1
BC137275 mRNA Translation: AAI37276.1
AK125459 mRNA Translation: BAC86170.1 Different initiation.
CCDSiCCDS34558.1 [Q8IVF5-1]
CCDS34559.1 [Q8IVF5-3]
RefSeqiNP_001010927.1, NM_001010927.2
NP_036586.2, NM_012454.3

3D structure databases

SMRiQ8IVF5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117621, 9 interactors
IntActiQ8IVF5, 7 interactors
MINTiQ8IVF5
STRINGi9606.ENSP00000437188

PTM databases

iPTMnetiQ8IVF5
PhosphoSitePlusiQ8IVF5

Polymorphism and mutation databases

BioMutaiTIAM2
DMDMi296453025

Proteomic databases

jPOSTiQ8IVF5
MaxQBiQ8IVF5
PaxDbiQ8IVF5
PeptideAtlasiQ8IVF5
PRIDEiQ8IVF5
ProteomicsDBi70693
70694 [Q8IVF5-2]
70695 [Q8IVF5-3]
70696 [Q8IVF5-4]
70697 [Q8IVF5-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000275246; ENSP00000275246; ENSG00000146426 [Q8IVF5-3]
ENST00000360366; ENSP00000353528; ENSG00000146426 [Q8IVF5-5]
ENST00000456877; ENSP00000407183; ENSG00000146426 [Q8IVF5-4]
ENST00000461783; ENSP00000437188; ENSG00000146426 [Q8IVF5-1]
ENST00000529824; ENSP00000433348; ENSG00000146426 [Q8IVF5-2]
GeneIDi26230
KEGGihsa:26230
UCSCiuc003qqb.3 human [Q8IVF5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26230
DisGeNETi26230

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TIAM2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0122219
HGNCiHGNC:11806 TIAM2
HPAiHPA011134
HPA013903
MIMi604709 gene
neXtProtiNX_Q8IVF5
OpenTargetsiENSG00000146426
PharmGKBiPA36515

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410ITS1 Eukaryota
ENOG410XPCM LUCA
GeneTreeiENSGT00940000157012
InParanoidiQ8IVF5
KOiK16847
OMAiENGFHYV
OrthoDBi34437at2759
PhylomeDBiQ8IVF5
TreeFamiTF319686

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-1989781 PPARA activates gene expression
R-HSA-416482 G alpha (12/13) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TIAM2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26230

Protein Ontology

More...
PROi
PR:Q8IVF5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000146426 Expressed in 186 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiQ8IVF5 baseline and differential
GenevisibleiQ8IVF5 HS

Family and domain databases

CDDicd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 2 hits
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR001478 PDZ
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR003116 RBD_dom
IPR040655 TIAM1_CC-Ex
PfamiView protein in Pfam
PF00595 PDZ, 1 hit
PF00169 PH, 1 hit
PF00621 RhoGEF, 1 hit
PF18385 Tiam_CC_Ex, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SM00233 PH, 2 hits
SM00455 RBD, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50106 PDZ, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS50898 RBD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTIAM2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IVF5
Secondary accession number(s): B2RP56
, C9JZV2, Q6NXN9, Q6ZUP9, Q9UFG6, Q9UKV9, Q9UKW0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: May 18, 2010
Last modified: May 8, 2019
This is version 137 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again