Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase SIAH1

Gene

SIAH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription regulation, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.19 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by interaction with SNCAIP (isoform 2, but not isoform 1). May be inhibited by interaction with PEG10.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi98Zinc 1By similarity1
Metal bindingi105Zinc 1By similarity1
Metal bindingi117Zinc 1By similarity1
Metal bindingi121Zinc 1By similarity1
Metal bindingi128Zinc 21
Metal bindingi135Zinc 21
Metal bindingi147Zinc 21
Metal bindingi152Zinc 21

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri41 – 76RING-typePROSITE-ProRule annotationAdd BLAST36
Zinc fingeri93 – 153SIAH-typePROSITE-ProRule annotationAdd BLAST61

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • identical protein binding Source: IntAct
  • protein C-terminus binding Source: UniProtKB
  • ubiquitin conjugating enzyme binding Source: GO_Central
  • ubiquitin protein ligase activity Source: MGI
  • ubiquitin-protein transferase activity Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Transferase
Biological processApoptosis, Cell cycle, Differentiation, Spermatogenesis, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
6.3.2.19 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-373752 Netrin-1 signaling
R-HSA-977225 Amyloid fiber formation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q8IUQ4

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q8IUQ4 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase SIAH1 (EC:2.3.2.27)
Alternative name(s):
RING-type E3 ubiquitin transferase SIAH1Curated
Seven in absentia homolog 1
Short name:
Siah-1
Siah-1a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SIAH1
Synonyms:HUMSIAH
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000196470.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10857 SIAH1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602212 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q8IUQ4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi19S → A: Impaired ATM mediated phosphorylation, but normal interaction with HIPK2 and HIPK2 subsequent proteasomal degradation. 1 Publication1
Mutagenesisi19S → D: Reduced interaction with HIPK2 and HIPK2 subsequent proteasomal degradation. 1 Publication1
Mutagenesisi40E → R: Loss of function. 1 Publication1
Mutagenesisi41C → S: Loss of function; when associated with S-44. 1 Publication1
Mutagenesisi44C → S: Loss of function. 2 Publications1
Mutagenesisi55C → A: Loss of function; when associated with A-59 and S-72. 2 Publications1
Mutagenesisi55C → S: Loss of function; when associated with Y-59. 2 Publications1
Mutagenesisi59H → A: Loss of function; when associated with A-55 and S-72. 2 Publications1
Mutagenesisi59H → Y: Loss of function. 2 Publications1
Mutagenesisi66R → L: Decreased activity; when associated with T-68. 1 Publication1
Mutagenesisi68K → T: Decreased activity; when associated with L-66. 1 Publication1
Mutagenesisi72C → S: Loss of function; when associated with A-55 and A-59. 1 Publication1
Mutagenesisi76R → E: Decreased activity. 1 Publication1
Mutagenesisi124R → A in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-214; A-215; A-231 and A-232. 1
Mutagenesisi142D → A in E; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-151. 1
Mutagenesisi151Q → A in E; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-142. 1
Mutagenesisi152H → Y: Abolishes ability to degrade DCC. 1 Publication1
Mutagenesisi161 – 162ED → AA in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-226 and A-237. 2
Mutagenesisi198 – 200KYD → GDG: Impairs CTNNB1 degradation. 1 Publication3
Mutagenesisi202H → Y: No effect. 1 Publication1
Mutagenesisi211L → R: Abolishes ability to degrade DCC. 1 Publication1
Mutagenesisi214 – 215TR → AA in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-124; A-231 and A-232. 2
Mutagenesisi224R → A in C; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-233. 1
Mutagenesisi226E → A in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-161; A-162 and A-237. 1
Mutagenesisi231 – 232RR → AA in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-124; A-214 and A-215. 2
Mutagenesisi233R → A in C; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-233. 1
Mutagenesisi237E → A in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-161; A-162 and A-226. 1
Mutagenesisi252M → D or K: Impairs CTNNB1 degradation. 1 Publication1
Mutagenesisi253N → A in B; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-265. 1
Mutagenesisi265Q → A in B; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-253. 1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6477

Open Targets

More...
OpenTargetsi
ENSG00000196470

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35759

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SIAH1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
46577493

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000561631 – 282E3 ubiquitin-protein ligase SIAH1Add BLAST282

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei19Phosphoserine; by ATM and ATR1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Ser-19 by ATM and ATR. This phosphorylation disrupts SIAH1 interaction with HIPK2, and subsequent proteasomal degradation of HIPK2.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8IUQ4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8IUQ4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IUQ4

PeptideAtlas

More...
PeptideAtlasi
Q8IUQ4

PRoteomics IDEntifications database

More...
PRIDEi
Q8IUQ4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
70593
70594 [Q8IUQ4-2]
70595 [Q8IUQ4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8IUQ4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8IUQ4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

May be induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response. The relevance of such activity in vivo is however unclear and may not exist.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196470 Expressed in 227 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_SIAH1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IUQ4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IUQ4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018724

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with group 1 glutamate receptors GRM1 and GRM5. Interacts with DAB1, which may inhibit its activity. Interacts with UBE2E2. Interacts with PEG3. Interacts with GAPDH; leading to stabilize SIAH1 (By similarity). Component of some large E3 complex composed of UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Interacts with UBE2I. Interacts with alpha-tubulin. Interacts with PEG10, which may inhibit its activity. Interacts with KHDRBS3. Interacts with SNCAIP and HIPK2.By similarity11 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-747107,EBI-747107
Q59GP63EBI-747107,EBI-10243413
AASDHPPTQ9NRN73EBI-747107,EBI-740884
AFF4Q9UHB75EBI-747107,EBI-395282
AFF4Q9UHB7-25EBI-747107,EBI-10261324
AQP1P299723EBI-747107,EBI-745213
ARMC9Q7Z3E5-23EBI-747107,EBI-10256990
ATXN7O152652EBI-747107,EBI-708350
AXIN1A0A0S2Z4M13EBI-11522811,EBI-16429430
BCL6P411823EBI-747107,EBI-765407
CAPGP401213EBI-747107,EBI-4291044
CCDC198Q9NVL83EBI-747107,EBI-10238351
CDC23Q9UJX23EBI-747107,EBI-396137
CDC34P494273EBI-747107,EBI-975634
CDK5R1Q8N6193EBI-747107,EBI-10266998
CDK5R1Q8TAM43EBI-747107,EBI-10271838
DDX41Q9UJV93EBI-747107,EBI-1046350
DNAJC15Q9Y5T43EBI-747107,EBI-10329228
DNALI1O146453EBI-747107,EBI-395638
EEF1DP296924EBI-747107,EBI-358607
EXOC3-AS1Q8N2X63EBI-747107,EBI-749333
FAM90A1Q86YD73EBI-747107,EBI-6658203
FLI1Q015433EBI-747107,EBI-2271018
FZD9Q8TAN23EBI-747107,EBI-741016
GDPD5Q8WTR43EBI-747107,EBI-2833203
HIST2H4BP628053EBI-747107,EBI-302023
INHAP051113EBI-747107,EBI-10194422
IQCNQ9H0B33EBI-747107,EBI-745878
KATNAL1Q9BW623EBI-747107,EBI-743591
KCNJ10P785083EBI-747107,EBI-9117877
KIAA0319LQ8IZA03EBI-747107,EBI-5240269
KIAA1217Q5T5P2-63EBI-747107,EBI-10188326
KIF1BO603333EBI-747107,EBI-465633
KIFC3Q9BVG83EBI-747107,EBI-2125614
LACTB2Q53H823EBI-747107,EBI-3943430
MAB21L1Q133943EBI-747107,EBI-10229059
MAPK12P537783EBI-747107,EBI-602406
MAPKBP1O603363EBI-747107,EBI-947402
MOB3CQ70IA83EBI-747107,EBI-9679267
MTIF3Q9H2K03EBI-747107,EBI-3923617
MX1P205913EBI-747107,EBI-929476
MYD88Q998363EBI-747107,EBI-447677
NECTIN2Q926923EBI-747107,EBI-718419
NELFAQ9H3P23EBI-747107,EBI-5461341
NOL6Q9H6R4-43EBI-747107,EBI-10307896
OPRM1P353724EBI-747107,EBI-2624570
OTUB2Q96DC93EBI-747107,EBI-746259
PEG10Q86TG73EBI-747107,EBI-2858265
PFKMP082373EBI-747107,EBI-514788
PHC2Q8IXK05EBI-747107,EBI-713786
PIMREGQ9BSJ63EBI-11522811,EBI-2568609
POU2AF1Q166332EBI-747107,EBI-943588
Pou2af1Q646935EBI-747107,EBI-943530From Mus musculus.
PRPF31Q8WWY33EBI-747107,EBI-1567797
PRR20CP864795EBI-747107,EBI-10172814
PTPMT1Q8WUK03EBI-747107,EBI-7199479
PUF60Q9UHX17EBI-747107,EBI-1053259
PYGBP112163EBI-747107,EBI-1047231
QRICH1Q2TAL83EBI-747107,EBI-2798044
RAB33AQ140883EBI-747107,EBI-744685
RAD51AP1Q96B013EBI-747107,EBI-1178724
RAD51AP1Q96B01-23EBI-747107,EBI-1178743
RAD54L2Q9Y4B43EBI-747107,EBI-948156
RPS19BP1Q86WX33EBI-747107,EBI-4479407
RXRBP28702-33EBI-11522811,EBI-16429492
SDCBPO005603EBI-747107,EBI-727004
SEPT4O43236-62EBI-747107,EBI-4372019
Sh3rf1Q69ZI15EBI-747107,EBI-957380From Mus musculus.
SPATA4Q8NEY33EBI-747107,EBI-7067221
SPATC1LQ9H0A93EBI-747107,EBI-372911
SYT7O435813EBI-747107,EBI-10184345
TBC1D22BQ9NU193EBI-747107,EBI-8787464
TMEM43Q9BTV43EBI-11522811,EBI-721293
TOLLIPQ6FIE93EBI-747107,EBI-10249783
TP53BP2Q13625-33EBI-747107,EBI-10175039
TRIM23P364063EBI-747107,EBI-740098
TRIM27P143733EBI-747107,EBI-719493
TRIM7Q9C0293EBI-747107,EBI-2813981
UBE2KP610864EBI-747107,EBI-473850
UPP2A0A0S2Z6393EBI-11522811,EBI-16440814
UPP2A0A0S2Z6U53EBI-11522811,EBI-16432858
UPP2O950453EBI-747107,EBI-10191025
UPP2O95045-26EBI-11522811,EBI-11528386
UXTQ9UBK93EBI-747107,EBI-357355
WDYHV1Q96HA83EBI-747107,EBI-741158
XP697134EBI-747107,EBI-7088789From Hepatitis B virus genotype A2 subtype adw2 (strain Rutter 1979).
XIAPP981703EBI-747107,EBI-517127
ZBP1A2RRL93EBI-747107,EBI-10173066
ZCCHC10Q8TBK63EBI-747107,EBI-597063
ZCCHC13Q8WW363EBI-747107,EBI-954111
ZFYVE21Q9BQ243EBI-747107,EBI-2849569
ZMAT3Q9HA383EBI-747107,EBI-2548480
ZNF148Q9UQR13EBI-747107,EBI-2688184
ZNF512BQ96KM63EBI-747107,EBI-1049952

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112372, 172 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8IUQ4

Database of interacting proteins

More...
DIPi
DIP-35684N

Protein interaction database and analysis system

More...
IntActi
Q8IUQ4, 132 interactors

Molecular INTeraction database

More...
MINTi
Q8IUQ4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000349156

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1282
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8IUQ4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8IUQ4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8IUQ4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni90 – 282SBDAdd BLAST193

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING-type zinc finger domain is essential for ubiquitin ligase activity.
The SBD domain (substrate-binding domain) mediates the homodimerization and the interaction with substrate proteins. It is related to the TRAF family.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SINA (Seven in absentia) family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri41 – 76RING-typePROSITE-ProRule annotationAdd BLAST36
Zinc fingeri93 – 153SIAH-typePROSITE-ProRule annotationAdd BLAST61

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3002 Eukaryota
ENOG410XVP0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154837

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231487

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG055701

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IUQ4

KEGG Orthology (KO)

More...
KOi
K04506

Identification of Orthologs from Complete Genome Data

More...
OMAi
EACEFRP

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0BPY

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8IUQ4

TreeFam database of animal gene trees

More...
TreeFami
TF312976

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.210.10, 1 hit
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018121 7-in-absentia-prot_TRAF-dom
IPR004162 SINA-like
IPR008974 TRAF-like
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR013010 Znf_SIAH

The PANTHER Classification System

More...
PANTHERi
PTHR10315 PTHR10315, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03145 Sina, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49599 SSF49599, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50089 ZF_RING_2, 1 hit
PS51081 ZF_SIAH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IUQ4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRQTATALP TGTSKCPPSQ RVPALTGTTA SNNDLASLFE CPVCFDYVLP
60 70 80 90 100
PILQCQSGHL VCSNCRPKLT CCPTCRGPLG SIRNLAMEKV ANSVLFPCKY
110 120 130 140 150
ASSGCEITLP HTEKADHEEL CEFRPYSCPC PGASCKWQGS LDAVMPHLMH
160 170 180 190 200
QHKSITTLQG EDIVFLATDI NLPGAVDWVM MQSCFGFHFM LVLEKQEKYD
210 220 230 240 250
GHQQFFAIVQ LIGTRKQAEN FAYRLELNGH RRRLTWEATP RSIHEGIATA
260 270 280
IMNSDCLVFD TSIAQLFAEN GNLGINVTIS MC
Length:282
Mass (Da):31,123
Last modified:April 26, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFA0698D0DC1B0A15
GO
Isoform 2 (identifier: Q8IUQ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTGKATPPSLYSWRGVLFTCLPAARTRKRKEM

Show »
Length:313
Mass (Da):34,628
Checksum:iBE3085493B0ABEC1
GO
Isoform 3 (identifier: Q8IUQ4-3) [UniParc]FASTAAdd to basket
Also known as: Siah-1S

The sequence of this isoform differs from the canonical sequence as follows:
     193-195: LEK → DLS
     196-282: Missing.

Show »
Length:195
Mass (Da):21,215
Checksum:iB5AB8D4079A7C723
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BU09H3BU09_HUMAN
E3 ubiquitin-protein ligase SIAH1
SIAH1
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti173P → S in CAE46191 (PubMed:17974005).Curated1
Sequence conflicti245E → G in CAE46191 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0101661M → MTGKATPPSLYSWRGVLFTC LPAARTRKRKEM in isoform 2. 2 Publications1
Alternative sequenceiVSP_029210193 – 195LEK → DLS in isoform 3. 1 Publication3
Alternative sequenceiVSP_029211196 – 282Missing in isoform 3. 1 PublicationAdd BLAST87

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U63295 mRNA Translation: AAC12950.1
U76247 mRNA Translation: AAC51907.1
AJ400626 Genomic DNA Translation: CAC35542.1
EF026094 mRNA Translation: ABK15529.1
BX647064 mRNA Translation: CAE46191.1
BC035562 mRNA Translation: AAH35562.1
BC042550 mRNA Translation: AAH42550.1
BC044920 mRNA Translation: AAH44920.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10735.1 [Q8IUQ4-1]
CCDS32444.1 [Q8IUQ4-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001006611.1, NM_001006610.1 [Q8IUQ4-2]
NP_003022.3, NM_003031.3 [Q8IUQ4-1]
XP_006721309.1, XM_006721246.1 [Q8IUQ4-1]
XP_011521581.1, XM_011523279.1 [Q8IUQ4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.706828

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356721; ENSP00000349156; ENSG00000196470 [Q8IUQ4-2]
ENST00000380006; ENSP00000369343; ENSG00000196470 [Q8IUQ4-1]
ENST00000394725; ENSP00000378214; ENSG00000196470 [Q8IUQ4-1]
ENST00000568007; ENSP00000456421; ENSG00000196470 [Q8IUQ4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6477

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6477

UCSC genome browser

More...
UCSCi
uc002efl.4 human [Q8IUQ4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U63295 mRNA Translation: AAC12950.1
U76247 mRNA Translation: AAC51907.1
AJ400626 Genomic DNA Translation: CAC35542.1
EF026094 mRNA Translation: ABK15529.1
BX647064 mRNA Translation: CAE46191.1
BC035562 mRNA Translation: AAH35562.1
BC042550 mRNA Translation: AAH42550.1
BC044920 mRNA Translation: AAH44920.1
CCDSiCCDS10735.1 [Q8IUQ4-1]
CCDS32444.1 [Q8IUQ4-2]
RefSeqiNP_001006611.1, NM_001006610.1 [Q8IUQ4-2]
NP_003022.3, NM_003031.3 [Q8IUQ4-1]
XP_006721309.1, XM_006721246.1 [Q8IUQ4-1]
XP_011521581.1, XM_011523279.1 [Q8IUQ4-1]
UniGeneiHs.706828

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A25X-ray2.20A90-282[»]
4C9ZX-ray1.95A/B91-282[»]
4CA1X-ray1.58A/B91-282[»]
4I7BX-ray3.00A/C90-282[»]
4I7CX-ray2.80A/C90-282[»]
4I7DX-ray2.40A/C90-282[»]
4X3GX-ray2.34A/B91-282[»]
5WZZX-ray2.10A/B/C/D93-282[»]
ProteinModelPortaliQ8IUQ4
SMRiQ8IUQ4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112372, 172 interactors
CORUMiQ8IUQ4
DIPiDIP-35684N
IntActiQ8IUQ4, 132 interactors
MINTiQ8IUQ4
STRINGi9606.ENSP00000349156

Protein family/group databases

MoonDBiQ8IUQ4 Predicted

PTM databases

iPTMnetiQ8IUQ4
PhosphoSitePlusiQ8IUQ4

Polymorphism and mutation databases

BioMutaiSIAH1
DMDMi46577493

Proteomic databases

EPDiQ8IUQ4
MaxQBiQ8IUQ4
PaxDbiQ8IUQ4
PeptideAtlasiQ8IUQ4
PRIDEiQ8IUQ4
ProteomicsDBi70593
70594 [Q8IUQ4-2]
70595 [Q8IUQ4-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6477
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356721; ENSP00000349156; ENSG00000196470 [Q8IUQ4-2]
ENST00000380006; ENSP00000369343; ENSG00000196470 [Q8IUQ4-1]
ENST00000394725; ENSP00000378214; ENSG00000196470 [Q8IUQ4-1]
ENST00000568007; ENSP00000456421; ENSG00000196470 [Q8IUQ4-1]
GeneIDi6477
KEGGihsa:6477
UCSCiuc002efl.4 human [Q8IUQ4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6477
DisGeNETi6477
EuPathDBiHostDB:ENSG00000196470.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SIAH1
HGNCiHGNC:10857 SIAH1
HPAiCAB018724
MIMi602212 gene
neXtProtiNX_Q8IUQ4
OpenTargetsiENSG00000196470
PharmGKBiPA35759

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3002 Eukaryota
ENOG410XVP0 LUCA
GeneTreeiENSGT00940000154837
HOGENOMiHOG000231487
HOVERGENiHBG055701
InParanoidiQ8IUQ4
KOiK04506
OMAiEACEFRP
OrthoDBiEOG091G0BPY
PhylomeDBiQ8IUQ4
TreeFamiTF312976

Enzyme and pathway databases

UniPathwayi
UPA00143

BRENDAi6.3.2.19 2681
ReactomeiR-HSA-373752 Netrin-1 signaling
R-HSA-977225 Amyloid fiber formation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ8IUQ4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SIAH1 human
EvolutionaryTraceiQ8IUQ4

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SIAH1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6477

Protein Ontology

More...
PROi
PR:Q8IUQ4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000196470 Expressed in 227 organ(s), highest expression level in secondary oocyte
CleanExiHS_SIAH1
ExpressionAtlasiQ8IUQ4 baseline and differential
GenevisibleiQ8IUQ4 HS

Family and domain databases

Gene3Di2.60.210.10, 1 hit
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR018121 7-in-absentia-prot_TRAF-dom
IPR004162 SINA-like
IPR008974 TRAF-like
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR013010 Znf_SIAH
PANTHERiPTHR10315 PTHR10315, 1 hit
PfamiView protein in Pfam
PF03145 Sina, 1 hit
SUPFAMiSSF49599 SSF49599, 1 hit
PROSITEiView protein in PROSITE
PS50089 ZF_RING_2, 1 hit
PS51081 ZF_SIAH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSIAH1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IUQ4
Secondary accession number(s): A0FKF3
, O43269, Q49A58, Q92880
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: December 5, 2018
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again