Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8IUQ4 (SIAH1_HUMAN)

Entry version 190 (07 Apr 2021)
Sequence version 2 (26 Apr 2004)
Previous versions | rss
Add a publicationFeedback
Protein

E3 ubiquitin-protein ligase SIAH1

Gene

SIAH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:14506261, PubMed:14645235, PubMed:14654780, PubMed:15064394, PubMed:16085652, PubMed:19224863, PubMed:20508617, PubMed:22483617, PubMed:9334332, PubMed:9858595). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (PubMed:14506261, PubMed:14645235, PubMed:14654780, PubMed:15064394, PubMed:16085652, PubMed:19224863, PubMed:20508617, PubMed:22483617, PubMed:9334332, PubMed:9858595). Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes (PubMed:14506261, PubMed:14645235, PubMed:14654780, PubMed:15064394, PubMed:16085652, PubMed:19224863, PubMed:20508617, PubMed:22483617, PubMed:9334332, PubMed:9858595). Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (ELL2, MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP (PubMed:10747903, PubMed:11146551, PubMed:11389839, PubMed:11389840, PubMed:11483517, PubMed:11483518, PubMed:11752454, PubMed:12072443). Confers constitutive instability to HIPK2 through proteasomal degradation (PubMed:18536714). It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription regulation, spermatogenesis and TNF-alpha signaling (PubMed:14506261, PubMed:14645235, PubMed:14654780, PubMed:15064394, PubMed:16085652, PubMed:19224863, PubMed:20508617, PubMed:22483617, PubMed:9334332, PubMed:9858595). Has some overlapping function with SIAH2 (PubMed:14506261, PubMed:14645235, PubMed:14654780, PubMed:15064394, PubMed:16085652, PubMed:19224863, PubMed:20508617, PubMed:22483617, PubMed:9334332, PubMed:9858595). Induces apoptosis in cooperation with PEG3 (By similarity). Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus (By similarity). GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins (By similarity). Mediates ubiquitination and degradation of EGLN2 and EGLN3 in response to the unfolded protein response (UPR), leading to their degradation and subsequent stabilization of ATF4 (By similarity).By similarity19 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by interaction with SNCAIP (isoform 2, but not isoform 1). May be inhibited by interaction with PEG10.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi98Zinc 1By similarity1
Metal bindingi105Zinc 1By similarity1
Metal bindingi117Zinc 1By similarity1
Metal bindingi121Zinc 1By similarity1
Metal bindingi128Zinc 21
Metal bindingi135Zinc 21
Metal bindingi147Zinc 21
Metal bindingi152Zinc 21

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri41 – 76RING-typePROSITE-ProRule annotationAdd BLAST36
Zinc fingeri93 – 153SIAH-typePROSITE-ProRule annotationAdd BLAST61

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Transferase
Biological processApoptosis, Cell cycle, Differentiation, Spermatogenesis, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		6.3.2.19, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q8IUQ4

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-373752, Netrin-1 signaling
R-HSA-977225, Amyloid fiber formation
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q8IUQ4

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00143

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...MoonDBi		Q8IUQ4, Predicted

Transport Classification Database

More...TCDBi		8.A.133.1.1, the siah1 e3 ubiquitin-protein ligase (siah1) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase SIAH1 (EC:2.3.2.27)
Alternative name(s):
RING-type E3 ubiquitin transferase SIAH1Curated
Seven in absentia homolog 1
Short name:
Siah-1
Siah-1a
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SIAH1
Synonyms:HUMSIAH
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10857, SIAH1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602212, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q8IUQ4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000196470.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi19S → A: Impaired ATM mediated phosphorylation, but normal interaction with HIPK2 and HIPK2 subsequent proteasomal degradation. 1 Publication1
Mutagenesisi19S → D: Reduced interaction with HIPK2 and HIPK2 subsequent proteasomal degradation. 1 Publication1
Mutagenesisi40E → R: Loss of function. 1 Publication1
Mutagenesisi41C → S: Loss of function; when associated with S-44. 1 Publication1
Mutagenesisi44C → S: Loss of function. 2 Publications1
Mutagenesisi55C → A: Loss of function; when associated with A-59 and S-72. 2 Publications1
Mutagenesisi55C → S: Loss of function; when associated with Y-59. 2 Publications1
Mutagenesisi59H → A: Loss of function; when associated with A-55 and S-72. 2 Publications1
Mutagenesisi59H → Y: Loss of function. 2 Publications1
Mutagenesisi66R → L: Decreased activity; when associated with T-68. 1 Publication1
Mutagenesisi68K → T: Decreased activity; when associated with L-66. 1 Publication1
Mutagenesisi72C → S: Loss of function; when associated with A-55 and A-59. 1 Publication1
Mutagenesisi76R → E: Decreased activity. 1 Publication1
Mutagenesisi124R → A in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-214; A-215; A-231 and A-232. 1
Mutagenesisi142D → A in E; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-151. 1
Mutagenesisi151Q → A in E; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-142. 1
Mutagenesisi152H → Y: Abolishes ability to degrade DCC. 1 Publication1
Mutagenesisi161 – 162ED → AA in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-226 and A-237. 2
Mutagenesisi198 – 200KYD → GDG: Impairs CTNNB1 degradation. 1 Publication3
Mutagenesisi202H → Y: No effect. 1 Publication1
Mutagenesisi211L → R: Abolishes ability to degrade DCC. 1 Publication1
Mutagenesisi214 – 215TR → AA in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-124; A-231 and A-232. 2
Mutagenesisi224R → A in C; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-233. 1
Mutagenesisi226E → A in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-161; A-162 and A-237. 1
Mutagenesisi231 – 232RR → AA in D; does not impair its ability to interact with CACYBP and degrade CTNNB1 and PML; when associated with A-124; A-214 and A-215. 2
Mutagenesisi233R → A in C; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-233. 1
Mutagenesisi237E → A in A; does not impair its ability to degrade PML while it abolishes its ability to interact with CACYBP and degrade CTNNB1; when associated with A-161; A-162 and A-226. 1
Mutagenesisi252M → D or K: Impairs CTNNB1 degradation. 1 Publication1
Mutagenesisi253N → A in B; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-265. 1
Mutagenesisi265Q → A in B; does not impair its ability to interact with CACYBP and degrade CTNNB1; when associated with A-253. 1

Organism-specific databases

DisGeNET

More...DisGeNETi		6477

Open Targets

More...OpenTargetsi		ENSG00000196470

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35759

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q8IUQ4, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SIAH1

Domain mapping of disease mutations (DMDM)

More...DMDMi		46577493

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000561631 – 282E3 ubiquitin-protein ligase SIAH1Add BLAST282

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei19Phosphoserine; by ATM and ATR1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on Ser-19 by ATM and ATR. This phosphorylation disrupts SIAH1 interaction with HIPK2, and subsequent proteasomal degradation of HIPK2.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8IUQ4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q8IUQ4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q8IUQ4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8IUQ4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8IUQ4

PeptideAtlas

More...PeptideAtlasi		Q8IUQ4

PRoteomics IDEntifications database

More...PRIDEi		Q8IUQ4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		70593 [Q8IUQ4-1]
70594 [Q8IUQ4-2]
70595 [Q8IUQ4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8IUQ4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8IUQ4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

May be induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response. The relevance of such activity in vivo is however unclear and may not exist.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000196470, Expressed in secondary oocyte and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8IUQ4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8IUQ4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000196470, Tissue enhanced (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with group 1 glutamate receptors GRM1 and GRM5.

Interacts with DAB1, which may inhibit its activity.

Interacts with UBE2E2.

Interacts with PEG3.

Interacts with GAPDH; leading to stabilize SIAH1 (By similarity).

Component of some large E3 complex composed of UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X.

Interacts with UBE2I.

Interacts with alpha-tubulin.

Interacts with PEG10, which may inhibit its activity.

Interacts with KHDRBS3.

Interacts with SNCAIP and HIPK2.

Interacts with Bassoon/BSN and Piccolo/PLCO; these interactions negatively regulate SIAH1 E3 ligase activity (By similarity).

Interacts with DCC (PubMed:9334332).

By similarity11 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q8IUQ4
With#Exp.IntAct
AASDHPPT [Q9NRN7]3EBI-747107,EBI-740884
AFF4 [Q9UHB7]5EBI-747107,EBI-395282
AFF4 - isoform 2 [Q9UHB7-2]5EBI-747107,EBI-10261324
AQP1 [P29972]3EBI-747107,EBI-745213
ARMC9 - isoform 2 [Q7Z3E5-2]3EBI-747107,EBI-10256990
ATXN7 [O15265]2EBI-747107,EBI-708350
BCL6 [P41182]3EBI-747107,EBI-765407
CAPG [P40121]3EBI-747107,EBI-4291044
CCDC198 [Q9NVL8]3EBI-747107,EBI-10238351
CDC23 [Q9UJX2]3EBI-747107,EBI-396137
CDC34 [P49427]3EBI-747107,EBI-975634
CDK5R1 [Q8N619]3EBI-747107,EBI-10266998
CDK5R1 [Q8TAM4]3EBI-747107,EBI-10271838
DDX41 [Q9UJV9]3EBI-747107,EBI-1046350
DNAJC15 [Q9Y5T4]3EBI-747107,EBI-10329228
DNALI1 [O14645]3EBI-747107,EBI-395638
EEF1D [P29692]4EBI-747107,EBI-358607
EXOC3-AS1 [Q8N2X6]3EBI-747107,EBI-749333
FAM90A1 [Q86YD7]3EBI-747107,EBI-6658203
FLI1 [Q01543]3EBI-747107,EBI-2271018
FZD9 [Q8TAN2]3EBI-747107,EBI-741016
GDPD5 [Q8WTR4]3EBI-747107,EBI-2833203
H4C9 [P62805]3EBI-747107,EBI-302023
INHA [P05111]3EBI-747107,EBI-10194422
IQCN [Q9H0B3]3EBI-747107,EBI-745878
KATNAL1 [Q9BW62]3EBI-747107,EBI-743591
KCNJ10 [P78508]3EBI-747107,EBI-9117877
KIAA0319L [Q8IZA0]3EBI-747107,EBI-5240269
KIAA1217 - isoform 6 [Q5T5P2-6]3EBI-747107,EBI-10188326
KIF1B [O60333]3EBI-747107,EBI-465633
KIFC3 [Q9BVG8]3EBI-747107,EBI-2125614
LACTB2 [Q53H82]3EBI-747107,EBI-3943430
MAB21L1 [Q13394]3EBI-747107,EBI-10229059
MAPK12 [P53778]3EBI-747107,EBI-602406
MAPKBP1 [O60336]3EBI-747107,EBI-947402
MOB3C [Q70IA8]3EBI-747107,EBI-9679267
MTIF3 [Q9H2K0]3EBI-747107,EBI-3923617
MX1 [P20591]3EBI-747107,EBI-929476
MYD88 [Q99836]3EBI-747107,EBI-447677
NECTIN2 [Q92692]3EBI-747107,EBI-718419
NELFA [Q9H3P2]3EBI-747107,EBI-5461341
NOL6 - isoform 4 [Q9H6R4-4]3EBI-747107,EBI-10307896
NTAQ1 [Q96HA8]3EBI-747107,EBI-741158
OPRM1 [P35372]4EBI-747107,EBI-2624570
OTUB2 [Q96DC9]3EBI-747107,EBI-746259
PEG10 [Q86TG7]3EBI-747107,EBI-2858265
PFKM [P08237]3EBI-747107,EBI-514788
PHC2 [Q8IXK0]5EBI-747107,EBI-713786
POU2AF1 [Q16633]2EBI-747107,EBI-943588
PRPF31 [Q8WWY3]3EBI-747107,EBI-1567797
PRR20C [P86479]5EBI-747107,EBI-10172814
PTPMT1 [Q8WUK0]3EBI-747107,EBI-7199479
PUF60 [Q9UHX1]7EBI-747107,EBI-1053259
PYGB [P11216]3EBI-747107,EBI-1047231
QRICH1 [Q2TAL8]3EBI-747107,EBI-2798044
RAB33A [Q14088]3EBI-747107,EBI-744685
RAD51AP1 [Q96B01]3EBI-747107,EBI-1178724
RAD51AP1 - isoform 2 [Q96B01-2]3EBI-747107,EBI-1178743
RAD54L2 [Q9Y4B4]3EBI-747107,EBI-948156
RPS19BP1 [Q86WX3]3EBI-747107,EBI-4479407
SDCBP [O00560]3EBI-747107,EBI-727004
SEPTIN4 - isoform ARTS [O43236-6]2EBI-747107,EBI-4372019
itself3EBI-747107,EBI-747107
SPATA4 [Q8NEY3]3EBI-747107,EBI-7067221
SPATC1L [Q9H0A9]3EBI-747107,EBI-372911
SYT7 [O43581]3EBI-747107,EBI-10184345
TBC1D22B [Q9NU19]3EBI-747107,EBI-8787464
TMEM43 [Q9BTV4]3EBI-747107,EBI-721293
TOLLIP [Q6FIE9]3EBI-747107,EBI-10249783
TP53BP2 - isoform 3 [Q13625-3]3EBI-747107,EBI-10175039
TRIM23 [P36406]3EBI-747107,EBI-740098
TRIM27 [P14373]3EBI-747107,EBI-719493
TRIM7 [Q9C029]3EBI-747107,EBI-2813981
UBE2K [P61086]4EBI-747107,EBI-473850
UPP2 [O95045]3EBI-747107,EBI-10191025
UXT [Q9UBK9]3EBI-747107,EBI-357355
XIAP [P98170]3EBI-747107,EBI-517127
ZBP1 [A2RRL9]3EBI-747107,EBI-10173066
ZCCHC10 [Q8TBK6]3EBI-747107,EBI-597063
ZCCHC13 [Q8WW36]3EBI-747107,EBI-954111
ZFYVE21 [Q9BQ24]3EBI-747107,EBI-2849569
ZMAT3 [Q9HA38]3EBI-747107,EBI-2548480
ZNF148 [Q9UQR1]3EBI-747107,EBI-2688184
ZNF512B [Q96KM6]3EBI-747107,EBI-1049952
Q59GP63EBI-747107,EBI-10243413
Pou2af1 [Q64693] from Mus musculus.5EBI-747107,EBI-943530
Sh3rf1 [Q69ZI1] from Mus musculus.5EBI-747107,EBI-957380
X [P69713] from Hepatitis B virus genotype A2 subtype adw2 (strain Rutter 1979).4EBI-747107,EBI-7088789
Isoform 2 [Q8IUQ4-2]
With#Exp.IntAct
APLP2 - isoform 5 [Q06481-5]3EBI-11522811,EBI-25646567
APP [P05067]3EBI-11522811,EBI-77613
APP - isoform APP305 [P05067-2]3EBI-11522811,EBI-17264467
ATN1 [Q86V38]3EBI-11522811,EBI-11954292
ATXN1 [P54253]3EBI-11522811,EBI-930964
AXIN1 [A0A0S2Z4M1]3EBI-11522811,EBI-16429430
BAG3 [O95817]3EBI-11522811,EBI-747185
BAG4 [O95429]3EBI-11522811,EBI-2949658
COL26A1 - isoform 2 [Q96A83-2]3EBI-11522811,EBI-21553822
CSNK1D - isoform 2 [P48730-2]3EBI-11522811,EBI-9087876
INHA [P05111]3EBI-11522811,EBI-10194422
KLK6 [Q92876]3EBI-11522811,EBI-2432309
LANCL2 [Q9NS86]3EBI-11522811,EBI-2510837
M1AP [Q8TC57]3EBI-11522811,EBI-748182
MAPRE3 [Q9UPY8]3EBI-11522811,EBI-726739
NCOR1 [O75376]3EBI-11522811,EBI-347233
PIMREG [Q9BSJ6]3EBI-11522811,EBI-2568609
PRPF31 [Q8WWY3]3EBI-11522811,EBI-1567797
PRR20D [P86480]3EBI-11522811,EBI-12754095
RAB33B [Q9H082]3EBI-11522811,EBI-3048549
RAD51AP1 [Q96B01]3EBI-11522811,EBI-1178724
RXRB - isoform 2 [P28702-3]3EBI-11522811,EBI-16429492
SFMBT2 [Q5VUG0]3EBI-11522811,EBI-12025260
TARDBP [Q13148]3EBI-11522811,EBI-372899
TMEM43 [Q9BTV4]3EBI-11522811,EBI-721293
UBE2K [P61086]6EBI-11522811,EBI-473850
UPP2 [A0A0S2Z639]3EBI-11522811,EBI-16440814
UPP2 [A0A0S2Z6U5]3EBI-11522811,EBI-16432858
UPP2 - isoform 2 [O95045-2]6EBI-11522811,EBI-11528386

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112372, 200 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q8IUQ4

Database of interacting proteins

More...DIPi		DIP-35684N

Protein interaction database and analysis system

More...IntActi		Q8IUQ4, 150 interactors

Molecular INTeraction database

More...MINTi		Q8IUQ4

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000349156

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8IUQ4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1282
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8IUQ4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q8IUQ4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni90 – 282SBDAdd BLAST193

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING-type zinc finger domain is essential for ubiquitin ligase activity.
The SBD domain (substrate-binding domain) mediates the homodimerization and the interaction with substrate proteins. It is related to the TRAF family.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SINA (Seven in absentia) family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri41 – 76RING-typePROSITE-ProRule annotationAdd BLAST36
Zinc fingeri93 – 153SIAH-typePROSITE-ProRule annotationAdd BLAST61

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3002, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154837

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_028215_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8IUQ4

Identification of Orthologs from Complete Genome Data

More...OMAi		ADHEDAC

Database of Orthologous Groups

More...OrthoDBi		780610at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8IUQ4

TreeFam database of animal gene trees

More...TreeFami		TF312976

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.210.10, 1 hit
3.30.40.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00120

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018121, 7-in-absentia-prot_TRAF-dom
IPR004162, SINA-like_animal
IPR008974, TRAF-like
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR013010, Znf_SIAH

The PANTHER Classification System

More...PANTHERi		PTHR45877, PTHR45877, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03145, Sina, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49599, SSF49599, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50089, ZF_RING_2, 1 hit
PS51081, ZF_SIAH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8IUQ4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRQTATALP TGTSKCPPSQ RVPALTGTTA SNNDLASLFE CPVCFDYVLP 
        60         70         80         90        100
PILQCQSGHL VCSNCRPKLT CCPTCRGPLG SIRNLAMEKV ANSVLFPCKY 
       110        120        130        140        150
ASSGCEITLP HTEKADHEEL CEFRPYSCPC PGASCKWQGS LDAVMPHLMH 
       160        170        180        190        200
QHKSITTLQG EDIVFLATDI NLPGAVDWVM MQSCFGFHFM LVLEKQEKYD 
       210        220        230        240        250
GHQQFFAIVQ LIGTRKQAEN FAYRLELNGH RRRLTWEATP RSIHEGIATA 
       260        270        280 
IMNSDCLVFD TSIAQLFAEN GNLGINVTIS MC
Length:282
Mass (Da):31,123
Last modified:April 26, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFA0698D0DC1B0A15
GO
Isoform 2 (identifier: Q8IUQ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTGKATPPSLYSWRGVLFTCLPAARTRKRKEM

Show »
Length:313
Mass (Da):34,628
Checksum:iBE3085493B0ABEC1
GO
Isoform 3 (identifier: Q8IUQ4-3) [UniParc]FASTAAdd to basket
Also known as: Siah-1S

The sequence of this isoform differs from the canonical sequence as follows:
     193-195: LEK → DLS
     196-282: Missing.

Show »
Length:195
Mass (Da):21,215
Checksum:iB5AB8D4079A7C723
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BU09H3BU09_HUMAN
E3 ubiquitin-protein ligase SIAH1
SIAH1
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti173P → S in CAE46191 (PubMed:17974005).Curated1
Sequence conflicti245E → G in CAE46191 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0101661M → MTGKATPPSLYSWRGVLFTC LPAARTRKRKEM in isoform 2. 2 Publications1
Alternative sequenceiVSP_029210193 – 195LEK → DLS in isoform 3. 1 Publication3
Alternative sequenceiVSP_029211196 – 282Missing in isoform 3. 1 PublicationAdd BLAST87

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U63295 mRNA Translation: AAC12950.1
U76247 mRNA Translation: AAC51907.1
AJ400626 Genomic DNA Translation: CAC35542.1
EF026094 mRNA Translation: ABK15529.1
BX647064 mRNA Translation: CAE46191.1
BC035562 mRNA Translation: AAH35562.1
BC042550 mRNA Translation: AAH42550.1
BC044920 mRNA Translation: AAH44920.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10735.1 [Q8IUQ4-1]
CCDS32444.1 [Q8IUQ4-2]

NCBI Reference Sequences

More...RefSeqi		NP_001006611.1, NM_001006610.1 [Q8IUQ4-2]
NP_003022.3, NM_003031.3 [Q8IUQ4-1]
XP_006721309.1, XM_006721246.1 [Q8IUQ4-1]
XP_011521581.1, XM_011523279.1 [Q8IUQ4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000356721; ENSP00000349156; ENSG00000196470 [Q8IUQ4-2]
ENST00000380006; ENSP00000369343; ENSG00000196470 [Q8IUQ4-1]
ENST00000394725; ENSP00000378214; ENSG00000196470 [Q8IUQ4-1]
ENST00000568007; ENSP00000456421; ENSG00000196470 [Q8IUQ4-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6477

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6477

UCSC genome browser

More...UCSCi		uc002efl.4, human [Q8IUQ4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U63295 mRNA Translation: AAC12950.1
U76247 mRNA Translation: AAC51907.1
AJ400626 Genomic DNA Translation: CAC35542.1
EF026094 mRNA Translation: ABK15529.1
BX647064 mRNA Translation: CAE46191.1
BC035562 mRNA Translation: AAH35562.1
BC042550 mRNA Translation: AAH42550.1
BC044920 mRNA Translation: AAH44920.1
CCDSiCCDS10735.1 [Q8IUQ4-1]
CCDS32444.1 [Q8IUQ4-2]
RefSeqiNP_001006611.1, NM_001006610.1 [Q8IUQ4-2]
NP_003022.3, NM_003031.3 [Q8IUQ4-1]
XP_006721309.1, XM_006721246.1 [Q8IUQ4-1]
XP_011521581.1, XM_011523279.1 [Q8IUQ4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2A25X-ray2.20A90-282[»]
4C9ZX-ray1.95A/B91-282[»]
4CA1X-ray1.58A/B91-282[»]
4I7BX-ray3.00A/C90-282[»]
4I7CX-ray2.80A/C90-282[»]
4I7DX-ray2.40A/C90-282[»]
4X3GX-ray2.34A/B91-282[»]
5WZZX-ray2.10A/B/C/D93-282[»]
SMRiQ8IUQ4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112372, 200 interactors
CORUMiQ8IUQ4
DIPiDIP-35684N
IntActiQ8IUQ4, 150 interactors
MINTiQ8IUQ4
STRINGi9606.ENSP00000349156

Protein family/group databases

MoonDBiQ8IUQ4, Predicted
TCDBi8.A.133.1.1, the siah1 e3 ubiquitin-protein ligase (siah1) family

PTM databases

iPTMnetiQ8IUQ4
PhosphoSitePlusiQ8IUQ4

Genetic variation databases

BioMutaiSIAH1
DMDMi46577493

Proteomic databases

EPDiQ8IUQ4
jPOSTiQ8IUQ4
MassIVEiQ8IUQ4
MaxQBiQ8IUQ4
PaxDbiQ8IUQ4
PeptideAtlasiQ8IUQ4
PRIDEiQ8IUQ4
ProteomicsDBi70593 [Q8IUQ4-1]
70594 [Q8IUQ4-2]
70595 [Q8IUQ4-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		14482, 407 antibodies

The DNASU plasmid repository

More...DNASUi		6477

Genome annotation databases

EnsembliENST00000356721; ENSP00000349156; ENSG00000196470 [Q8IUQ4-2]
ENST00000380006; ENSP00000369343; ENSG00000196470 [Q8IUQ4-1]
ENST00000394725; ENSP00000378214; ENSG00000196470 [Q8IUQ4-1]
ENST00000568007; ENSP00000456421; ENSG00000196470 [Q8IUQ4-1]
GeneIDi6477
KEGGihsa:6477
UCSCiuc002efl.4, human [Q8IUQ4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6477
DisGeNETi6477

GeneCards: human genes, protein and diseases

More...GeneCardsi		SIAH1
HGNCiHGNC:10857, SIAH1
HPAiENSG00000196470, Tissue enhanced (placenta)
MIMi602212, gene
neXtProtiNX_Q8IUQ4
OpenTargetsiENSG00000196470
PharmGKBiPA35759
VEuPathDBiHostDB:ENSG00000196470.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3002, Eukaryota
GeneTreeiENSGT00940000154837
HOGENOMiCLU_028215_0_0_1
InParanoidiQ8IUQ4
OMAiADHEDAC
OrthoDBi780610at2759
PhylomeDBiQ8IUQ4
TreeFamiTF312976

Enzyme and pathway databases

UniPathwayiUPA00143
BRENDAi6.3.2.19, 2681
PathwayCommonsiQ8IUQ4
ReactomeiR-HSA-373752, Netrin-1 signaling
R-HSA-977225, Amyloid fiber formation
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation
SIGNORiQ8IUQ4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6477, 25 hits in 1011 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SIAH1, human
EvolutionaryTraceiQ8IUQ4

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SIAH1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6477
PharosiQ8IUQ4, Tbio

Protein Ontology

More...PROi		PR:Q8IUQ4
RNActiQ8IUQ4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000196470, Expressed in secondary oocyte and 239 other tissues
ExpressionAtlasiQ8IUQ4, baseline and differential
GenevisibleiQ8IUQ4, HS

Family and domain databases

Gene3Di2.60.210.10, 1 hit
3.30.40.10, 1 hit
IDEALiIID00120
InterProiView protein in InterPro
IPR018121, 7-in-absentia-prot_TRAF-dom
IPR004162, SINA-like_animal
IPR008974, TRAF-like
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR013010, Znf_SIAH
PANTHERiPTHR45877, PTHR45877, 1 hit
PfamiView protein in Pfam
PF03145, Sina, 1 hit
SUPFAMiSSF49599, SSF49599, 1 hit
PROSITEiView protein in PROSITE
PS50089, ZF_RING_2, 1 hit
PS51081, ZF_SIAH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSIAH1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IUQ4
Secondary accession number(s): A0FKF3
, O43269, Q49A58, Q92880
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: April 7, 2021
This is version 190 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again