Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (12 Aug 2020)
Sequence version 4 (16 Apr 2014)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Glucose transporter type 1

Gene

Glut1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Facilitative glucose transporter.Curated1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei391MonosaccharideBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processSugar transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-189200, Cellular hexose transport
R-DME-196836, Vitamin C (ascorbate) metabolism
R-DME-422356, Regulation of insulin secretion
R-DME-5653890, Lactose synthesis
R-DME-6798695, Neutrophil degranulation
R-DME-8981373, Intestinal hexose absorption

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glucose transporter type 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Glut1
ORF Names:CG43946
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0264574, Glut1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 67CytoplasmicSequence analysisAdd BLAST44
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei68 – 88Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini89 – 95ExtracellularSequence analysis7
Transmembranei96 – 116Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini117 – 127CytoplasmicSequence analysisAdd BLAST11
Transmembranei128 – 148Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini149 – 162ExtracellularSequence analysisAdd BLAST14
Transmembranei163 – 183Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini184 – 186CytoplasmicSequence analysis3
Transmembranei187 – 207Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini208 – 272ExtracellularSequence analysisAdd BLAST65
Transmembranei273 – 293Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini294 – 310CytoplasmicSequence analysisAdd BLAST17
Transmembranei311 – 331Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini332 – 339ExtracellularSequence analysis8
Transmembranei340 – 360Helical; Name=8Sequence analysisAdd BLAST21
Topological domaini361 – 372CytoplasmicSequence analysisAdd BLAST12
Transmembranei373 – 393Helical; Name=9Sequence analysisAdd BLAST21
Topological domaini394 – 405ExtracellularSequence analysisAdd BLAST12
Transmembranei406 – 426Helical; Name=10Sequence analysisAdd BLAST21
Topological domaini427 – 429CytoplasmicSequence analysis3
Transmembranei430 – 450Helical; Name=11Sequence analysisAdd BLAST21
Topological domaini451 – 534ExtracellularSequence analysisAdd BLAST84
Transmembranei535 – 555Helical; Name=12Sequence analysisAdd BLAST21
Topological domaini556 – 1440CytoplasmicSequence analysisAdd BLAST885

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000042867424 – 1440Glucose transporter type 1Add BLAST1417

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi460N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi480N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8IRI6

PRoteomics IDEntifications database

More...
PRIDEi
Q8IRI6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0264574, Expressed in saliva-secreting gland and 38 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8IRI6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8IRI6, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
63662, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q8IRI6, 2 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0305687

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni283 – 289Monosaccharide bindingBy similarity7

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi685 – 783His-richAdd BLAST99
Compositional biasi686 – 756Gln-richAdd BLAST71
Compositional biasi1148 – 1249Asn-richAdd BLAST102
Compositional biasi1375 – 1407His-richAdd BLAST33

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0569, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_004788_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8IRI6

KEGG Orthology (KO)

More...
KOi
K07299

Identification of Orthologs from Complete Genome Data

More...
OMAi
AACHFII

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020846, MFS_dom
IPR005828, MFS_sugar_transport-like
IPR036259, MFS_trans_sf
IPR003663, Sugar/inositol_transpt
IPR005829, Sugar_transporter_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00083, Sugar_tr, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00171, SUGRTRNSPORT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473, SSF103473, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00879, SP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50850, MFS, 1 hit
PS00217, SUGAR_TRANSPORT_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (16+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 16 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 16 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform P (identifier: Q8IRI6-5) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFLCAPGLT FFLTYSIFSA VLGMLQFGYN TGVINAPEKN IENFMKDVYK
60 70 80 90 100
DRYGEDISEE FIQQLYSVAV SIFAIGGMLG GFSGGWMANR FGRKGGLLLN
110 120 130 140 150
NVLGIAGACL MGFTKVSHSY EMLFLGRFII GVNCGLNTSL VPMYISEIAP
160 170 180 190 200
LNLRGGLGTV NQLAVTVGLL LSQVLGIEQI LGTNEGWPIL LGLAICPAIL
210 220 230 240 250
QLILLPVCPE SPRYLLITKQ WEEEARKALR RLRASGSVEE DIEEMRAEER
260 270 280 290 300
AQQSESHIST MELICSPTLR PPLIIGIVMQ LSQQFSGINA VFYYSTSLFM
310 320 330 340 350
SSGLTEESAK FATIGIGAIM VVMTLVSIPL MDRTGRRTLH LYGLGGMFIF
360 370 380 390 400
SIFITISFLI KEMIDWMSYL SVVATLGFVV FFAVGPGSIP WMITAELFSQ
410 420 430 440 450
GPRPSAMAIA VLVNWMANFV VGIGFPSMKT ALENYTFLPF SVFLAIFWIF
460 470 480 490 500
TYKKVPETKN KTFEEILALF RHNNGRSMLN CTNSLEPQSM NSGIEHAALM
510 520 530 540 550
VSEEKTQHDS LFGTTSFSLT VEGMGPYPLS DSTNLLGPGS SSYGPGGVLG
560 570 580 590 600
LAGSGSGLGG QCYTNYGTNL QTPQAARKCH YDEVDDYSFR RHSAHGRITQ
610 620 630 640 650
MKGKPLILGP TIKKDKKKER TDWLTASERF LEGGRSTHQG RSAASAPHHP
660 670 680 690 700
RQPPPVCPSS GPXLRSASPP DSASVRSTSR AEEPHQPQQV HHQQQQVHHQ
710 720 730 740 750
QQHQSRYATH EYVHCSYEKE VVCDQANPSQ APPQQPAPPV QQHQQQPPPP
760 770 780 790 800
LHHCQQRKHS HSPHHSRHTS PHSHHHHSHH SRHSRRSRRQ GSGSLPGAHQ
810 820 830 840 850
GSANHSVMRP SICTSRRHRS VTDISTTNVC QDPACSDREV QEIMVRRTCC
860 870 880 890 900
NTTATNSSSR TELAQCFAED LYGSSRRPSS CCTSSDYCYQ TDSTSLYGSR
910 920 930 940 950
SSLSRNNSIK SASALVRKHH RSQRSLLPEH RHPSYTSISL RGLNASRPNS
960 970 980 990 1000
QLGSLTSIFD RAKNMAPEGS TLERQSSKGA LGSSELPEYA CSPSPIRWSF
1010 1020 1030 1040 1050
LADGRSPSEM EGAVGGGPER EQEEEDKLDA WQVPEPEPEK KPCRKITTSS
1060 1070 1080 1090 1100
SVYDEGPSTS AAAARKRRGS KGSRGSKGSG SYHCEFEDEA TTTVMFHQDA
1110 1120 1130 1140 1150
GEAYNNCCSN NYNYIQCNTY LDQDLQITSE DIHQYLSKGD ATASDILNNS
1160 1170 1180 1190 1200
KNYPFQPSNA LEFQYKNNFQ QGQANANNNN TNTTNTASSD AAECFQNYRA
1210 1220 1230 1240 1250
ISKETNLNQT STEQLSPTNI NLSTSSNNIN IVFSSSLERN ANEVKFINNR
1260 1270 1280 1290 1300
SGASGGSEMG CEVGHHAGYL PYTYPSYDYT NMSGNSHFEK PLGIDELPKE
1310 1320 1330 1340 1350
FCGLEGAGGG GASTTSEHSS SLPSPQPLTH HQQLHHFESF DAASEHNLLA
1360 1370 1380 1390 1400
AQPMSPGSPL SGSVNPAGDD FVQMHHYHHA NSPHSQSHHS HAHTHTHGHH
1410 1420 1430 1440
VHHLLNHPAY DLTDDQFRLG SALKRVRKRA RKYTDFLRKK
Length:1,440
Mass (Da):158,555
Last modified:April 16, 2014 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2F25FBC5E83AA97C
GO
Isoform B1 Publication (identifier: Q8IRI6-2) [UniParc]FASTAAdd to basket
Also known as: C1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Show »
Length:481
Mass (Da):53,171
Checksum:i3026AEEE777DB41E
GO
Isoform D (identifier: Q8IRI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Show »
Length:508
Mass (Da):55,817
Checksum:iF25CA8E2BA9223CC
GO
Isoform L (identifier: Q8IRI6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MSMNLSAKLD...HRRKLRLLEQ
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Show »
Length:602
Mass (Da):67,096
Checksum:iD5F2B65EA765DF01
GO
Isoform S (identifier: Q8IRI6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     362-411: EMIDWMSYLS...PRPSAMAIAV → ASIVVSRILE...FSDLHMTLKS
     412-1440: Missing.

Show »
Length:647
Mass (Da):72,191
Checksum:iC05E8E4FE249C2FB
GO
Isoform U (identifier: Q8IRI6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     8-72: GLTFFLTYSI...QQLYSVAVSI → NQLPTTQSQT...TQTNLSPITT
     73-1440: Missing.

Show »
Length:308
Mass (Da):35,173
Checksum:iD56CBE3B1AD45AFC
GO
Isoform Q (identifier: Q8IRI6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     511-625: LFGTTSFSLT...KKKERTDWLT → P

Show »
Length:1,326
Mass (Da):146,370
Checksum:iDA49A545476927C3
GO
Isoform M (identifier: Q8IRI6-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-478: RSM → SRA
     479-1440: Missing.

Show »
Length:478
Mass (Da):52,729
Checksum:iC1682C041E6CE2BA
GO
Isoform J (identifier: Q8IRI6-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     511-625: LFGTTSFSLT...KKKERTDWLT → P
     663-1440: Missing.

Show »
Length:548
Mass (Da):60,199
Checksum:i4E44C85D7C91FF81
GO
Isoform O (identifier: Q8IRI6-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-7: P → PVKRDMVAIKHELDTVQQVKEEIEELREYVDRLEEHTHRRKLRLLEQVCSLNYLPCC
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Show »
Length:571
Mass (Da):63,506
Checksum:iC6EBA87A5A544E13
GO
Isoform R (identifier: Q8IRI6-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...QMQMLFGLAS
     362-362: E → EFFGYVQE
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Show »
Length:802
Mass (Da):89,630
Checksum:i3686233B4CACD72D
GO
Isoform W (identifier: Q8IRI6-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     476-508: RSMLNCTNSLEPQSMNSGIEHAALMVSEEKTQH → SEDNANGNSVTTADFELSQNDGEEKGGVHAKAQ
     509-1440: Missing.

Show »
Length:744
Mass (Da):83,045
Checksum:i605975D5CFFFC251
GO
Isoform X (identifier: Q8IRI6-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     511-625: LFGTTSFSLT...KKKERTDWLT → P
     663-1440: Missing.

Show »
Length:784
Mass (Da):87,427
Checksum:iBBFE9FC3379FBFE8
GO
Isoform V (identifier: Q8IRI6-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MAFLCAP → MATIGDLSMI...HRRKLRLLEQ
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Show »
Length:717
Mass (Da):80,398
Checksum:i3BAF1601C3481C2F
GO
Isoform E (identifier: Q8IRI6-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     362-362: E → EFFGYVQE
     477-481: SMLNC → YVSLH
     482-1440: Missing.

Show »
Length:488
Mass (Da):54,042
Checksum:iA8C1F942766F1EF1
GO
Isoform T (identifier: Q8IRI6-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-149: MAFLCAPGLT...LVPMYISEIA → MATIGDLSMI...LLEFAQVMFS
     150-1440: Missing.

Show »
Length:149
Mass (Da):16,880
Checksum:i641B3D1483ACA4AA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X2JBV9X2JBV9_DROME
Glucose transporter 1, isoform Z
Glut1 0074, 12, CG1086, CG13908, Dmel\CG43946
548Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X2JG36X2JG36_DROME
Glucose transporter 1, isoform Y
Glut1 0074, 12, CG1086, CG13908, Dmel\CG43946
662Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0S0WFC8A0A0S0WFC8_DROME
Glucose transporter 1, isoform AA
Glut1 0074, 12, CG1086, CG13908, Dmel\CG43946
622Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL13347 differs from that shown. Reason: Frameshift.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0541931 – 149MAFLC…ISEIA → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LEFAQVMFS in isoform T. CuratedAdd BLAST149
Alternative sequenceiVSP_0541941 – 7MAFLCAP → MSMNLSAKLDELQRGDRHLE TTVALCEIRTQLQELTKSVE SCQSEVSEVKRDMVAIKHEL DTVQQVKEEIEELREYVDRL EEHTHRRKLRLLEQ in isoform L. Curated7
Alternative sequenceiVSP_0541951 – 7MAFLCAP → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LDLQKQVSVMSMNLSAKLDE LQRGDRHLETTVALCEIRTQ LQELTKSVESCQSEVSEVKR DMVAIKHELDTVQQVKEEIE ELREYVDRLEEHTHRRKLRL LEQNQLPTTQSQTTTRPKNH PELPEHPSTQPHKTTDGRNC HHDGQMQMLFGLAS in isoform R. Curated7
Alternative sequenceiVSP_0541961 – 7MAFLCAP → MATIGDLSMISPPTSSISND QDPFGQLPPLPPPLRSTQVL QPLSVFPVSNLSEDSYDYVF GGRRKTPPTTTSTQLKLTSP PVRLRPEDAYRGANINNGRF YRHSFSYAPKRQRHSSRDDR DRESRLRCHGEDEATLRQLL LDLQKQVSVMSMNLSAKLDE LQRGDRHLETTVALCEIRTQ LQELTKSVESCQSEVSEVKR DMVAIKHELDTVQQVKEEIE ELREYVDRLEEHTHRRKLRL LEQ in isoform S, isoform U, isoform W, isoform X and isoform V. 1 Publication7
Alternative sequenceiVSP_0541977P → PVKRDMVAIKHELDTVQQVK EEIEELREYVDRLEEHTHRR KLRLLEQVCSLNYLPCC in isoform O. Curated1
Alternative sequenceiVSP_0541988 – 72GLTFF…VAVSI → NQLPTTQSQTTTRPKNHPEL PEHPSTQPHKTTDGRNCHHD GQMQMLFGLASVSVHTQTNL SPITT in isoform U. CuratedAdd BLAST65
Alternative sequenceiVSP_05419973 – 1440Missing in isoform U. CuratedAdd BLAST1368
Alternative sequenceiVSP_054200150 – 1440Missing in isoform T. CuratedAdd BLAST1291
Alternative sequenceiVSP_054201362 – 411EMIDW…MAIAV → ASIVVSRILESCSCSCRVMP ANVNAKMPASLGLHLFVPRP FSDLHMTLKS in isoform S. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_054202362E → EFFGYVQE in isoform L, isoform E, isoform O and isoform R. 1 Publication1
Alternative sequenceiVSP_054203412 – 1440Missing in isoform S. 1 PublicationAdd BLAST1029
Alternative sequenceiVSP_054204476 – 508RSMLN…EKTQH → SEDNANGNSVTTADFELSQN DGEEKGGVHAKAQ in isoform D, isoform L, isoform O, isoform R and isoform W. CuratedAdd BLAST33
Alternative sequenceiVSP_054205476 – 478RSM → SRA in isoform M. Curated3
Alternative sequenceiVSP_054206477 – 481SMLNC → YVSLH in isoform B, isoform E and isoform V. 2 Publications5
Alternative sequenceiVSP_054207479 – 1440Missing in isoform M. CuratedAdd BLAST962
Alternative sequenceiVSP_054208482 – 1440Missing in isoform B, isoform E and isoform V. 2 PublicationsAdd BLAST959
Alternative sequenceiVSP_054209509 – 1440Missing in isoform D, isoform L, isoform O, isoform R and isoform W. CuratedAdd BLAST932
Alternative sequenceiVSP_054210511 – 625LFGTT…TDWLT → P in isoform Q, isoform J and isoform X. CuratedAdd BLAST115
Alternative sequenceiVSP_054211663 – 1440Missing in isoform J and isoform X. CuratedAdd BLAST778

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF064703 mRNA Translation: AAC36683.2
AE014296 Genomic DNA Translation: AAF47434.2
AE014296 Genomic DNA Translation: AAN11454.5
AE014296 Genomic DNA Translation: ABW08432.1
AE014296 Genomic DNA Translation: ABW08433.1
AE014296 Genomic DNA Translation: ABW08434.2
AE014296 Genomic DNA Translation: ABW08435.2
AE014296 Genomic DNA Translation: AGB93925.1
AE014296 Genomic DNA Translation: AGB93926.1
AE014296 Genomic DNA Translation: AGB93927.1
AE014296 Genomic DNA Translation: AGB93928.1
AE014296 Genomic DNA Translation: AGB93929.1
AE014296 Genomic DNA Translation: AGB93930.1
AE014296 Genomic DNA Translation: AGB93931.1
AE014296 Genomic DNA Translation: AGB93932.1
AE014296 Genomic DNA Translation: AGB93933.1
AY059441 mRNA Translation: AAL13347.1 Frameshift.
BT011383 mRNA Translation: AAR96175.1

NCBI Reference Sequences

More...
RefSeqi
NP_001097467.1, NM_001103997.3 [Q8IRI6-3]
NP_001097468.1, NM_001103998.3 [Q8IRI6-17]
NP_001097469.2, NM_001103999.4 [Q8IRI6-6]
NP_001097470.2, NM_001104000.2 [Q8IRI6-9]
NP_001261230.1, NM_001274301.1 [Q8IRI6-10]
NP_001261231.1, NM_001274302.1 [Q8IRI6-11]
NP_001261232.1, NM_001274303.1 [Q8IRI6-12]
NP_001261233.1, NM_001274304.1 [Q8IRI6-13]
NP_001261234.1, NM_001274305.1 [Q8IRI6-18]
NP_001261235.1, NM_001274306.1 [Q8IRI6-8]
NP_001261236.1, NM_001274307.1 [Q8IRI6-16]
NP_001261237.1, NM_001274308.1 [Q8IRI6-14]
NP_001261238.1, NM_001274309.1 [Q8IRI6-15]
NP_001286896.1, NM_001299967.1 [Q8IRI6-11]
NP_523878.1, NM_079154.3 [Q8IRI6-2]
NP_612073.2, NM_138229.2 [Q8IRI6-5]
NP_728557.1, NM_167845.3 [Q8IRI6-2]
NP_728558.5, NM_167846.3 [Q8IRI6-7]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0333493; FBpp0305677; FBgn0264574 [Q8IRI6-10]
FBtr0333494; FBpp0305678; FBgn0264574 [Q8IRI6-6]
FBtr0333495; FBpp0305679; FBgn0264574 [Q8IRI6-11]
FBtr0333496; FBpp0305680; FBgn0264574 [Q8IRI6-2]
FBtr0333497; FBpp0305681; FBgn0264574 [Q8IRI6-2]
FBtr0333498; FBpp0305682; FBgn0264574 [Q8IRI6-3]
FBtr0333499; FBpp0305683; FBgn0264574 [Q8IRI6-17]
FBtr0333500; FBpp0305684; FBgn0264574 [Q8IRI6-12]
FBtr0333501; FBpp0305685; FBgn0264574 [Q8IRI6-5]
FBtr0333502; FBpp0305686; FBgn0264574 [Q8IRI6-9]
FBtr0333503; FBpp0305687; FBgn0264574 [Q8IRI6-13]
FBtr0333504; FBpp0305688; FBgn0264574 [Q8IRI6-7]
FBtr0333505; FBpp0305689; FBgn0264574 [Q8IRI6-18]
FBtr0333506; FBpp0305690; FBgn0264574 [Q8IRI6-8]
FBtr0333507; FBpp0305691; FBgn0264574 [Q8IRI6-16]
FBtr0333508; FBpp0305692; FBgn0264574 [Q8IRI6-14]
FBtr0333509; FBpp0305693; FBgn0264574 [Q8IRI6-15]
FBtr0345690; FBpp0311739; FBgn0264574 [Q8IRI6-11]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
38109

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG43946

UCSC genome browser

More...
UCSCi
CG1086-RD, d. melanogaster
CG1086-RE, d. melanogaster
CG1086-RF, d. melanogaster
CG13908-RA, d. melanogaster
CG13908-RB, d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF064703 mRNA Translation: AAC36683.2
AE014296 Genomic DNA Translation: AAF47434.2
AE014296 Genomic DNA Translation: AAN11454.5
AE014296 Genomic DNA Translation: ABW08432.1
AE014296 Genomic DNA Translation: ABW08433.1
AE014296 Genomic DNA Translation: ABW08434.2
AE014296 Genomic DNA Translation: ABW08435.2
AE014296 Genomic DNA Translation: AGB93925.1
AE014296 Genomic DNA Translation: AGB93926.1
AE014296 Genomic DNA Translation: AGB93927.1
AE014296 Genomic DNA Translation: AGB93928.1
AE014296 Genomic DNA Translation: AGB93929.1
AE014296 Genomic DNA Translation: AGB93930.1
AE014296 Genomic DNA Translation: AGB93931.1
AE014296 Genomic DNA Translation: AGB93932.1
AE014296 Genomic DNA Translation: AGB93933.1
AY059441 mRNA Translation: AAL13347.1 Frameshift.
BT011383 mRNA Translation: AAR96175.1
RefSeqiNP_001097467.1, NM_001103997.3 [Q8IRI6-3]
NP_001097468.1, NM_001103998.3 [Q8IRI6-17]
NP_001097469.2, NM_001103999.4 [Q8IRI6-6]
NP_001097470.2, NM_001104000.2 [Q8IRI6-9]
NP_001261230.1, NM_001274301.1 [Q8IRI6-10]
NP_001261231.1, NM_001274302.1 [Q8IRI6-11]
NP_001261232.1, NM_001274303.1 [Q8IRI6-12]
NP_001261233.1, NM_001274304.1 [Q8IRI6-13]
NP_001261234.1, NM_001274305.1 [Q8IRI6-18]
NP_001261235.1, NM_001274306.1 [Q8IRI6-8]
NP_001261236.1, NM_001274307.1 [Q8IRI6-16]
NP_001261237.1, NM_001274308.1 [Q8IRI6-14]
NP_001261238.1, NM_001274309.1 [Q8IRI6-15]
NP_001286896.1, NM_001299967.1 [Q8IRI6-11]
NP_523878.1, NM_079154.3 [Q8IRI6-2]
NP_612073.2, NM_138229.2 [Q8IRI6-5]
NP_728557.1, NM_167845.3 [Q8IRI6-2]
NP_728558.5, NM_167846.3 [Q8IRI6-7]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

Protein-protein interaction databases

BioGRIDi63662, 2 interactors
IntActiQ8IRI6, 2 interactors
STRINGi7227.FBpp0305687

Proteomic databases

PaxDbiQ8IRI6
PRIDEiQ8IRI6

Genome annotation databases

EnsemblMetazoaiFBtr0333493; FBpp0305677; FBgn0264574 [Q8IRI6-10]
FBtr0333494; FBpp0305678; FBgn0264574 [Q8IRI6-6]
FBtr0333495; FBpp0305679; FBgn0264574 [Q8IRI6-11]
FBtr0333496; FBpp0305680; FBgn0264574 [Q8IRI6-2]
FBtr0333497; FBpp0305681; FBgn0264574 [Q8IRI6-2]
FBtr0333498; FBpp0305682; FBgn0264574 [Q8IRI6-3]
FBtr0333499; FBpp0305683; FBgn0264574 [Q8IRI6-17]
FBtr0333500; FBpp0305684; FBgn0264574 [Q8IRI6-12]
FBtr0333501; FBpp0305685; FBgn0264574 [Q8IRI6-5]
FBtr0333502; FBpp0305686; FBgn0264574 [Q8IRI6-9]
FBtr0333503; FBpp0305687; FBgn0264574 [Q8IRI6-13]
FBtr0333504; FBpp0305688; FBgn0264574 [Q8IRI6-7]
FBtr0333505; FBpp0305689; FBgn0264574 [Q8IRI6-18]
FBtr0333506; FBpp0305690; FBgn0264574 [Q8IRI6-8]
FBtr0333507; FBpp0305691; FBgn0264574 [Q8IRI6-16]
FBtr0333508; FBpp0305692; FBgn0264574 [Q8IRI6-14]
FBtr0333509; FBpp0305693; FBgn0264574 [Q8IRI6-15]
FBtr0345690; FBpp0311739; FBgn0264574 [Q8IRI6-11]
GeneIDi38109
KEGGidme:Dmel_CG43946
UCSCiCG1086-RD, d. melanogaster
CG1086-RE, d. melanogaster
CG1086-RF, d. melanogaster
CG13908-RA, d. melanogaster
CG13908-RB, d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
38109
FlyBaseiFBgn0264574, Glut1

Phylogenomic databases

eggNOGiKOG0569, Eukaryota
HOGENOMiCLU_004788_0_0_1
InParanoidiQ8IRI6
KOiK07299
OMAiAACHFII

Enzyme and pathway databases

ReactomeiR-DME-189200, Cellular hexose transport
R-DME-196836, Vitamin C (ascorbate) metabolism
R-DME-422356, Regulation of insulin secretion
R-DME-5653890, Lactose synthesis
R-DME-6798695, Neutrophil degranulation
R-DME-8981373, Intestinal hexose absorption

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
38109, 0 hits in 5 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Glut1, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
38109

Protein Ontology

More...
PROi
PR:Q8IRI6

Gene expression databases

BgeeiFBgn0264574, Expressed in saliva-secreting gland and 38 other tissues
ExpressionAtlasiQ8IRI6, baseline and differential
GenevisibleiQ8IRI6, DM

Family and domain databases

InterProiView protein in InterPro
IPR020846, MFS_dom
IPR005828, MFS_sugar_transport-like
IPR036259, MFS_trans_sf
IPR003663, Sugar/inositol_transpt
IPR005829, Sugar_transporter_CS
PfamiView protein in Pfam
PF00083, Sugar_tr, 1 hit
PRINTSiPR00171, SUGRTRNSPORT
SUPFAMiSSF103473, SSF103473, 1 hit
TIGRFAMsiTIGR00879, SP, 1 hit
PROSITEiView protein in PROSITE
PS50850, MFS, 1 hit
PS00217, SUGAR_TRANSPORT_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGTR1_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8IRI6
Secondary accession number(s): A8JNH6
, A8JNH8, A8JNH9, M9PBH4, M9PBH5, M9PDK7, M9PDL1, M9PDS4, M9PDS9, M9PE46, M9PGN5, M9PGP2, O77131, Q0E8K0, Q6NNA9, Q95TE8, Q9V409, Q9W0L2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: April 16, 2014
Last modified: August 12, 2020
This is version 146 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again