Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Potassium voltage-gated channel protein shk-1

Gene

shk-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates the voltage-dependent potassium ion permeability of excitable membranes. Has an important role in repolarization and in regulating the pattern of action potential firing. Isoform a expresses currents in a more depolarized voltage range than isoform d.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • delayed rectifier potassium channel activity Source: WormBase
  • voltage-gated potassium channel activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandPotassium

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.1.2.20 the voltage-gated ion channel (vic) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Potassium voltage-gated channel protein shk-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:shk-1Imported
ORF Names:ZK1321.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome II

Organism-specific databases

WormBase

More...
WormBasei
ZK1321.2a ; CE32769 ; WBGene00014261 ; shk-1
ZK1321.2b ; CE32770 ; WBGene00014261 ; shk-1
ZK1321.2c ; CE32771 ; WBGene00014261 ; shk-1
ZK1321.2d ; CE32772 ; WBGene00014261 ; shk-1
ZK1321.2e ; CE36966 ; WBGene00014261 ; shk-1
ZK1321.2f ; CE40295 ; WBGene00014261 ; shk-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 275CytoplasmicSequence analysisAdd BLAST275
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei276 – 296Helical; Name=Segment S1Sequence analysisAdd BLAST21
Topological domaini297 – 322ExtracellularSequence analysisAdd BLAST26
Transmembranei323 – 343Helical; Name=Segment S2Sequence analysisAdd BLAST21
Topological domaini344 – 356CytoplasmicSequence analysisAdd BLAST13
Transmembranei357 – 377Helical; Name=Segment S3Sequence analysisAdd BLAST21
Topological domaini378 – 425ExtracellularSequence analysisAdd BLAST48
Transmembranei426 – 446Helical; Voltage-sensor; Name=Segment S4Sequence analysisAdd BLAST21
Topological domaini447 – 458CytoplasmicSequence analysisAdd BLAST12
Transmembranei459 – 479Helical; Name=Segment S5Sequence analysisAdd BLAST21
Topological domaini480 – 486ExtracellularSequence analysis7
Transmembranei487 – 507Helical; Name=Segment S6Sequence analysisAdd BLAST21
Topological domaini508 – 536CytoplasmicSequence analysisAdd BLAST29

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Delayed spike repolarization.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004206231 – 536Potassium voltage-gated channel protein shk-1Add BLAST536

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8I4B0

PeptideAtlas

More...
PeptideAtlasi
Q8I4B0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a variety of interneurons and sensory neurons, as well as body wall muscle.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00014261 Expressed in 4 organ(s), highest expression level in multi-cellular organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.ZK1321.2c

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8I4B0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1545 Eukaryota
COG1226 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000164717

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231015

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8I4B0

KEGG Orthology (KO)

More...
KOi
K04874

Identification of Orthologs from Complete Genome Data

More...
OMAi
IHRIDNT

Database of Orthologous Groups

More...
OrthoDBi
EOG091G10NU

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8I4B0

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005821 Ion_trans_dom
IPR003968 K_chnl_volt-dep_Kv
IPR011333 SKP1/BTB/POZ_sf
IPR003131 T1-type_BTB
IPR028325 VG_K_chnl
IPR027359 Volt_channel_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11537 PTHR11537, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02214 BTB_2, 1 hit
PF00520 Ion_trans, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00169 KCHANNEL
PR01491 KVCHANNEL

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54695 SSF54695, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform c1 Publication (identifier: Q8I4B0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRFGGQRRCI ESSDDNDSID SMSIQQKNKE KEEWKWAQSL ARRLEQVLNV
60 70 80 90 100
HPEKYQNGCS SQRPSRQPSP VEQLAPIRSH SADFGRAAEM ASGNSEEGKG
110 120 130 140 150
MLLRNGDDRI RLPSPQRGTP DTSSTQGHPY TDQIVTINVS GMRFQTFEST
160 170 180 190 200
LSRYPNSLLG DRNKRQHFFV SDTNEFFFDR HRTTSSSFTF EIRNYLFESI
210 220 230 240 250
LYIYQSGGRV KRPEIVPIDI FLKEMRFFQM GDDLLEEFWI AEGYEKPKEV
260 270 280 290 300
MMPNNKTQRK IWELMEYPDS SLSARIIAFI SIAVIALSII SFCWETVPSD
310 320 330 340 350
IEEKPINNSA TAELLDEMDE KHYSPFFWIE LMCILWFTIE LILRFISCPC
360 370 380 390 400
KVTFATSVLN IIDFVAIAPF FVNFFFADTS KSNSSMSFAV LRVLRLVRVF
410 420 430 440 450
RVFKLSRHSV GLQILGKTFR SSVQEFCLLI FFMAIALVLF ASGMYFAEQG
460 470 480 490 500
EPNSKFTSIP ASFWFVLVTM TTVGYGDLVP LSPFGKVVGG MCAMIGVLTL
510 520 530
ALPVPIIVAN FKHFYRQENR LASMKSKGDD ADDDIA
Note: No experimental confirmation available.Curated
Length:536
Mass (Da):61,234
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9662A84009CF0632
GO
Isoform b1 Publication (identifier: Q8I4B0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:524
Mass (Da):59,789
Checksum:i4C9297157383F759
GO
Isoform d1 Publication (identifier: Q8I4B0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MRFGGQRRCIESSDDNDSIDSMSIQQKNKEKEEWKWAQSLA → MIDSLI

Note: No experimental confirmation available.Curated
Show »
Length:501
Mass (Da):57,092
Checksum:iD4DD985C2408D1A3
GO
Isoform a1 Publication (identifier: Q8I4B0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     42-85: RRLEQVLNVHPEKYQNGCSSQRPSRQPSPVEQLAPIRSHSADFG → S
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:481
Mass (Da):54,893
Checksum:iE3B676ED326076C0
GO
Isoform e1 Publication (identifier: Q8I4B0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MRFGGQRRCI...PIRSHSADFG → MWRFNRIKS
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:448
Mass (Da):51,210
Checksum:i9FD7F69E72C95645
GO
Isoform f1 Publication (identifier: Q8I4B0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: Missing.
     185-196: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:435
Mass (Da):49,563
Checksum:i623A4AC29A712E09
GO
Isoform g1 Publication (identifier: Q8I4B0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-536: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:125
Mass (Da):14,057
Checksum:i72547C0E6847CA57
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0445701 – 89Missing in isoform f. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0445711 – 85MRFGG…SADFG → MWRFNRIKS in isoform e. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_0445721 – 41MRFGG…AQSLA → MIDSLI in isoform d. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_04457342 – 85RRLEQ…SADFG → S in isoform a. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_044574126 – 536Missing in isoform g. 1 PublicationAdd BLAST411
Alternative sequenceiVSP_044575185 – 196Missing in isoform b, isoform a, isoform e and isoform f. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z48584 Genomic DNA Translation: CAA88477.2
Z48584 Genomic DNA Translation: CAD57715.1
Z48584 Genomic DNA Translation: CAD57716.1
Z48584 Genomic DNA Translation: CAD57717.1
Z48584 Genomic DNA Translation: CAH04712.1
Z48584 Genomic DNA Translation: CAK55179.1
Z48584 Genomic DNA Translation: CBX53352.1

NCBI Reference Sequences

More...
RefSeqi
NP_001022516.1, NM_001027345.2 [Q8I4B0-5]
NP_001040829.1, NM_001047364.2 [Q8I4B0-6]
NP_001254226.1, NM_001267297.1
NP_496104.2, NM_063703.4 [Q8I4B0-4]
NP_871934.1, NM_182134.3 [Q8I4B0-2]
NP_871935.1, NM_182135.4 [Q8I4B0-1]
NP_871936.1, NM_182136.4 [Q8I4B0-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Cel.7785

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
ZK1321.2a; ZK1321.2a; WBGene00014261 [Q8I4B0-4]
ZK1321.2b; ZK1321.2b; WBGene00014261 [Q8I4B0-2]
ZK1321.2c; ZK1321.2c; WBGene00014261 [Q8I4B0-1]
ZK1321.2d.1; ZK1321.2d.1; WBGene00014261 [Q8I4B0-3]
ZK1321.2d.2; ZK1321.2d.2; WBGene00014261 [Q8I4B0-3]
ZK1321.2e; ZK1321.2e; WBGene00014261 [Q8I4B0-5]
ZK1321.2f.1; ZK1321.2f.1; WBGene00014261 [Q8I4B0-6]
ZK1321.2f.2; ZK1321.2f.2; WBGene00014261 [Q8I4B0-6]
ZK1321.2g; ZK1321.2g; WBGene00014261 [Q8I4B0-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
174536

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_ZK1321.2

UCSC genome browser

More...
UCSCi
ZK1321.2a c. elegans

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z48584 Genomic DNA Translation: CAA88477.2
Z48584 Genomic DNA Translation: CAD57715.1
Z48584 Genomic DNA Translation: CAD57716.1
Z48584 Genomic DNA Translation: CAD57717.1
Z48584 Genomic DNA Translation: CAH04712.1
Z48584 Genomic DNA Translation: CAK55179.1
Z48584 Genomic DNA Translation: CBX53352.1
RefSeqiNP_001022516.1, NM_001027345.2 [Q8I4B0-5]
NP_001040829.1, NM_001047364.2 [Q8I4B0-6]
NP_001254226.1, NM_001267297.1
NP_496104.2, NM_063703.4 [Q8I4B0-4]
NP_871934.1, NM_182134.3 [Q8I4B0-2]
NP_871935.1, NM_182135.4 [Q8I4B0-1]
NP_871936.1, NM_182136.4 [Q8I4B0-3]
UniGeneiCel.7785

3D structure databases

ProteinModelPortaliQ8I4B0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi6239.ZK1321.2c

Protein family/group databases

TCDBi1.A.1.2.20 the voltage-gated ion channel (vic) superfamily

Proteomic databases

PaxDbiQ8I4B0
PeptideAtlasiQ8I4B0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiZK1321.2a; ZK1321.2a; WBGene00014261 [Q8I4B0-4]
ZK1321.2b; ZK1321.2b; WBGene00014261 [Q8I4B0-2]
ZK1321.2c; ZK1321.2c; WBGene00014261 [Q8I4B0-1]
ZK1321.2d.1; ZK1321.2d.1; WBGene00014261 [Q8I4B0-3]
ZK1321.2d.2; ZK1321.2d.2; WBGene00014261 [Q8I4B0-3]
ZK1321.2e; ZK1321.2e; WBGene00014261 [Q8I4B0-5]
ZK1321.2f.1; ZK1321.2f.1; WBGene00014261 [Q8I4B0-6]
ZK1321.2f.2; ZK1321.2f.2; WBGene00014261 [Q8I4B0-6]
ZK1321.2g; ZK1321.2g; WBGene00014261 [Q8I4B0-7]
GeneIDi174536
KEGGicel:CELE_ZK1321.2
UCSCiZK1321.2a c. elegans

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
174536
WormBaseiZK1321.2a ; CE32769 ; WBGene00014261 ; shk-1
ZK1321.2b ; CE32770 ; WBGene00014261 ; shk-1
ZK1321.2c ; CE32771 ; WBGene00014261 ; shk-1
ZK1321.2d ; CE32772 ; WBGene00014261 ; shk-1
ZK1321.2e ; CE36966 ; WBGene00014261 ; shk-1
ZK1321.2f ; CE40295 ; WBGene00014261 ; shk-1

Phylogenomic databases

eggNOGiKOG1545 Eukaryota
COG1226 LUCA
GeneTreeiENSGT00940000164717
HOGENOMiHOG000231015
InParanoidiQ8I4B0
KOiK04874
OMAiIHRIDNT
OrthoDBiEOG091G10NU
PhylomeDBiQ8I4B0

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8I4B0

Gene expression databases

BgeeiWBGene00014261 Expressed in 4 organ(s), highest expression level in multi-cellular organism

Family and domain databases

Gene3Di1.20.120.350, 1 hit
InterProiView protein in InterPro
IPR005821 Ion_trans_dom
IPR003968 K_chnl_volt-dep_Kv
IPR011333 SKP1/BTB/POZ_sf
IPR003131 T1-type_BTB
IPR028325 VG_K_chnl
IPR027359 Volt_channel_dom_sf
PANTHERiPTHR11537 PTHR11537, 1 hit
PfamiView protein in Pfam
PF02214 BTB_2, 1 hit
PF00520 Ion_trans, 1 hit
PRINTSiPR00169 KCHANNEL
PR01491 KVCHANNEL
SUPFAMiSSF54695 SSF54695, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCNSK_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8I4B0
Secondary accession number(s): E3W725
, Q09658, Q14V33, Q6BEV2, Q8I4A9, Q8I4B1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: March 1, 2003
Last modified: December 5, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again