Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (02 Jun 2021)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Double-stranded RNA-binding protein Staufen homolog 2

Gene

Stau2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processTransport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Double-stranded RNA-binding protein Staufen homolog 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Stau2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1352508, Stau2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi235H → A: Abrogates RNA-binding by DRBM 3 and interaction with XPO5 and nuclear export; when associated with A-237. 1 Publication1
Mutagenesisi237K → A: Abrogates RNA-binding by DRBM 3 and interaction with XPO5 and nuclear export; when associated with A-235. 1 Publication1
Mutagenesisi273 – 274KK → AA: Prevents nuclear localization of mutants lacking DRBM 3 function; when associated with 289-AAA-291. 1 Publication2
Mutagenesisi289 – 291KKR → AAA: Prevents nuclear localization of mutants lacking DRBM 3 function; when associated with 257-AA-258. 1 Publication3

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000722471 – 570Double-stranded RNA-binding protein Staufen homolog 2Add BLAST570

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei188PhosphoserineBy similarity1
Modified residuei395PhosphoserineBy similarity1
Modified residuei405PhosphothreonineBy similarity1
Modified residuei416PhosphoserineBy similarity1
Modified residuei426PhosphoserineBy similarity1
Modified residuei440PhosphoserineBy similarity1
Modified residuei455PhosphoserineBy similarity1
Modified residuei492PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8CJ67

PeptideAtlas

More...
PeptideAtlasi
Q8CJ67

PRoteomics IDEntifications database

More...
PRIDEi
Q8CJ67

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
254582 [Q8CJ67-1]
254583 [Q8CJ67-2]
254584 [Q8CJ67-3]
254585 [Q8CJ67-4]
254586 [Q8CJ67-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8CJ67

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8CJ67

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and neurons, where isoform 2 and isoform 3 appear to be the most abundant. Expressed at the neuromuscular junction of the extensor digitorum longus, tibialis anterior and soleus muscles. Expression at neuromuscular junctions is most pronounced in slow-twitch muscle. Also weakly expressed in heart, kidney, ovary and testis.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression in extrasynaptic regions of muscle is induced by denervation. Expression in myoblasts is induced during differentiation into myotubes and by treatment with nerve derived trophic factors such as AGRN (agrin) and NRG1 (neuregulin).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000025920, Expressed in brain and 305 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8CJ67, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with microtubules. Isoform 2 and isoform 3 may also interact with ribosomes, and this association is independent of translation (By similarity).

Identified in a mRNP complex, at least composed of DHX9, DDX3X, ELAVL1, HNRNPU, IGF2BP1, ILF3, PABPC1, PCBP2, PTBP2, STAU1, STAU2, SYNCRIP and YBX1.

Interacts with the exportin XPO5. This requires RNA and RAN bound to GTP.

Interacts with TRIM71 (via NHL repeats) in an RNA-dependent manner (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
205899, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q8CJ67, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000124505

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8CJ67, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1570
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8CJ67

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8CJ67

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 75DRBM 1PROSITE-ProRule annotationAdd BLAST68
Domaini95 – 181DRBM 2PROSITE-ProRule annotationAdd BLAST87
Domaini207 – 274DRBM 3PROSITE-ProRule annotationAdd BLAST68
Domaini307 – 375DRBM 4PROSITE-ProRule annotationAdd BLAST69

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni71 – 94DisorderedSequence analysisAdd BLAST24
Regioni178 – 203DisorderedSequence analysisAdd BLAST26
Regioni381 – 570Required for dendritic transportBy similarityAdd BLAST190
Regioni381 – 413DisorderedSequence analysisAdd BLAST33
Regioni545 – 570DisorderedSequence analysisAdd BLAST26

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi273 – 291Nuclear localization signal 1Add BLAST19
Motifi373 – 412Nuclear localization signal 2By similarityAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi553 – 570Polar residuesSequence analysisAdd BLAST18

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export.2 Publications

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3732, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154977

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_162785_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8CJ67

Identification of Orthologs from Complete Genome Data

More...
OMAi
GMINQRY

Database of Orthologous Groups

More...
OrthoDBi
823092at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8CJ67

TreeFam database of animal gene trees

More...
TreeFami
TF350296

Family and domain databases

Conserved Domains Database

More...
CDDi
cd19880, DSRM_STAU2_rpt1, 1 hit
cd19882, DSRM_STAU2_rpt2, 1 hit
cd19884, DSRM_STAU2_rpt3, 1 hit
cd19886, DSRM_STAU2_rpt4, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014720, dsRBD_dom
IPR044476, STAU2_DSRM_1
IPR044464, STAU2_DSRM_2
IPR044473, STAU2_DSRM_3
IPR044474, STAU2_DSRM_4
IPR032478, Staufen_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00035, dsrm, 4 hits
PF16482, Staufen_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00358, DSRM, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50137, DS_RBD, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8CJ67-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANPKEKTPV CLVNELARFH SIQPQYKLLN ESGPAHSKMF SVQLSLGEQT
60 70 80 90 100
WESEGSSIKK AQQAVANKAL TESTLPKPVQ KPPKSNVNNN PGSITPTVEL
110 120 130 140 150
NGLAMKRGEP AIYRPLDPKP FPNYRANYNF RGMYNQRYHC PMPKIFYVQL
160 170 180 190 200
TVGNNEFFGE GKTRQAARHN AAMKALQALQ NEPIPEKSPQ NGESGKEMDD
210 220 230 240 250
DKDANKSEIS LVFEIALKRN MPVSFEVIKE SGPPHMKSFV TRVSVGEFSA
260 270 280 290 300
EGEGNSKKLS KKRAATTVLQ ELKKLPPLPV VEKPKLFFKK RPKTIVKAGP
310 320 330 340 350
DYGQGMNPIS RLAQIQQARK EKEPDYILLS ERGMPRRREF VMQVKVGNEV
360 370 380 390 400
ATGTGPNKKI AKKNAAEAML LQLGYKASTS LQDPLDKTGE NKGWSGPKPG
410 420 430 440 450
FPEPTNNTPK GILHLSPDVY QEMEASRHRV TSGTTLSYLS PKDMNQPSSS
460 470 480 490 500
FFSVSPSSTS SATVARELLM NGTSPTAEAI GLKGSSPTSP CSSVQPSKQL
510 520 530 540 550
EYLARIQGFQ AALSALKQFS EQGLESIDGA VNVEKGSLEK QAKHLREKAD
560 570
NNQAKPASIS QDCKKSKSAI
Length:570
Mass (Da):62,535
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3D7F2DA66B0B8D57
GO
Isoform 2 (identifier: Q8CJ67-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-38: GPAHSK → MLQINQ

Show »
Length:538
Mass (Da):59,004
Checksum:i6D746ED7D2A50F93
GO
Isoform 3 (identifier: Q8CJ67-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     33-38: GPAHSK → MLQINQ
     511-511: A → V
     512-570: Missing.

Show »
Length:479
Mass (Da):52,724
Checksum:iFBADDEACE1F3E8EF
GO
Isoform 4 (identifier: Q8CJ67-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-305: Missing.
     511-511: A → V
     512-570: Missing.

Show »
Length:206
Mass (Da):22,340
Checksum:i05E34194CA94AB03
GO
Isoform 5 (identifier: Q8CJ67-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-125: GSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYR → VGKLKETVLSPAHEVMIVGITHYSADNFFLHWCL
     126-570: Missing.

Show »
Length:125
Mass (Da):13,836
Checksum:i8D678D8578C536E1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z6D2D3Z6D2_MOUSE
Double-stranded RNA-binding protein...
Stau2
511Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E2QRQ3E2QRQ3_MOUSE
Double-stranded RNA-binding protein...
Stau2
473Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z461D3Z461_MOUSE
Double-stranded RNA-binding protein...
Stau2
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGR9D6RGR9_MOUSE
Double-stranded RNA-binding protein...
Stau2
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YXB2D3YXB2_MOUSE
Double-stranded RNA-binding protein...
Stau2
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CZD3E0CZD3_MOUSE
Double-stranded RNA-binding protein...
Stau2
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0153781 – 305Missing in isoform 4. 1 PublicationAdd BLAST305
Alternative sequenceiVSP_0153791 – 32Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_01538033 – 38GPAHSK → MLQINQ in isoform 2 and isoform 3. 2 Publications6
Alternative sequenceiVSP_01538192 – 125GSITP…FPNYR → VGKLKETVLSPAHEVMIVGI THYSADNFFLHWCL in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_015382126 – 570Missing in isoform 5. 1 PublicationAdd BLAST445
Alternative sequenceiVSP_015383511A → V in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_015384512 – 570Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF459099 mRNA Translation: AAN37928.1
AF459100 mRNA Translation: AAN37929.1
AK015087 mRNA Translation: BAB29708.1
AK028390 mRNA Translation: BAC25926.1
BC010300 mRNA Translation: AAH10300.1
BC025118 mRNA Translation: AAH25118.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14831.2 [Q8CJ67-1]
CCDS48223.1 [Q8CJ67-2]
CCDS83529.1 [Q8CJ67-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001104742.1, NM_001111272.1 [Q8CJ67-2]
NP_001333974.1, NM_001347045.1 [Q8CJ67-3]
NP_079579.2, NM_025303.3 [Q8CJ67-1]
XP_006495591.1, XM_006495528.3 [Q8CJ67-1]
XP_006495595.1, XM_006495532.3 [Q8CJ67-2]
XP_011236689.1, XM_011238387.1 [Q8CJ67-1]
XP_011236691.1, XM_011238389.1 [Q8CJ67-2]
XP_017176591.1, XM_017321102.1 [Q8CJ67-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000027052; ENSMUSP00000027052; ENSMUSG00000025920 [Q8CJ67-2]
ENSMUST00000054668; ENSMUSP00000053190; ENSMUSG00000025920 [Q8CJ67-1]
ENSMUST00000115359; ENSMUSP00000111016; ENSMUSG00000025920 [Q8CJ67-5]
ENSMUST00000144138; ENSMUSP00000119130; ENSMUSG00000025920 [Q8CJ67-5]
ENSMUST00000159558; ENSMUSP00000125726; ENSMUSG00000025920 [Q8CJ67-3]
ENSMUST00000162007; ENSMUSP00000124303; ENSMUSG00000025920 [Q8CJ67-3]
ENSMUST00000162435; ENSMUSP00000123827; ENSMUSG00000025920 [Q8CJ67-2]
ENSMUST00000162627; ENSMUSP00000123781; ENSMUSG00000025920 [Q8CJ67-2]
ENSMUST00000162751; ENSMUSP00000124505; ENSMUSG00000025920 [Q8CJ67-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29819

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:29819

UCSC genome browser

More...
UCSCi
uc007ajn.2, mouse [Q8CJ67-1]
uc007ajo.2, mouse [Q8CJ67-2]
uc007ajq.2, mouse [Q8CJ67-3]
uc007ajr.2, mouse [Q8CJ67-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF459099 mRNA Translation: AAN37928.1
AF459100 mRNA Translation: AAN37929.1
AK015087 mRNA Translation: BAB29708.1
AK028390 mRNA Translation: BAC25926.1
BC010300 mRNA Translation: AAH10300.1
BC025118 mRNA Translation: AAH25118.1
CCDSiCCDS14831.2 [Q8CJ67-1]
CCDS48223.1 [Q8CJ67-2]
CCDS83529.1 [Q8CJ67-3]
RefSeqiNP_001104742.1, NM_001111272.1 [Q8CJ67-2]
NP_001333974.1, NM_001347045.1 [Q8CJ67-3]
NP_079579.2, NM_025303.3 [Q8CJ67-1]
XP_006495591.1, XM_006495528.3 [Q8CJ67-1]
XP_006495595.1, XM_006495532.3 [Q8CJ67-2]
XP_011236689.1, XM_011238387.1 [Q8CJ67-1]
XP_011236691.1, XM_011238389.1 [Q8CJ67-2]
XP_017176591.1, XM_017321102.1 [Q8CJ67-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UHZNMR-A308-383[»]
SMRiQ8CJ67
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi205899, 10 interactors
IntActiQ8CJ67, 2 interactors
STRINGi10090.ENSMUSP00000124505

PTM databases

iPTMnetiQ8CJ67
PhosphoSitePlusiQ8CJ67

Proteomic databases

PaxDbiQ8CJ67
PeptideAtlasiQ8CJ67
PRIDEiQ8CJ67
ProteomicsDBi254582 [Q8CJ67-1]
254583 [Q8CJ67-2]
254584 [Q8CJ67-3]
254585 [Q8CJ67-4]
254586 [Q8CJ67-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1305, 234 antibodies

The DNASU plasmid repository

More...
DNASUi
29819

Genome annotation databases

EnsembliENSMUST00000027052; ENSMUSP00000027052; ENSMUSG00000025920 [Q8CJ67-2]
ENSMUST00000054668; ENSMUSP00000053190; ENSMUSG00000025920 [Q8CJ67-1]
ENSMUST00000115359; ENSMUSP00000111016; ENSMUSG00000025920 [Q8CJ67-5]
ENSMUST00000144138; ENSMUSP00000119130; ENSMUSG00000025920 [Q8CJ67-5]
ENSMUST00000159558; ENSMUSP00000125726; ENSMUSG00000025920 [Q8CJ67-3]
ENSMUST00000162007; ENSMUSP00000124303; ENSMUSG00000025920 [Q8CJ67-3]
ENSMUST00000162435; ENSMUSP00000123827; ENSMUSG00000025920 [Q8CJ67-2]
ENSMUST00000162627; ENSMUSP00000123781; ENSMUSG00000025920 [Q8CJ67-2]
ENSMUST00000162751; ENSMUSP00000124505; ENSMUSG00000025920 [Q8CJ67-1]
GeneIDi29819
KEGGimmu:29819
UCSCiuc007ajn.2, mouse [Q8CJ67-1]
uc007ajo.2, mouse [Q8CJ67-2]
uc007ajq.2, mouse [Q8CJ67-3]
uc007ajr.2, mouse [Q8CJ67-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27067
MGIiMGI:1352508, Stau2

Phylogenomic databases

eggNOGiKOG3732, Eukaryota
GeneTreeiENSGT00940000154977
HOGENOMiCLU_162785_0_0_1
InParanoidiQ8CJ67
OMAiGMINQRY
OrthoDBi823092at2759
PhylomeDBiQ8CJ67
TreeFamiTF350296

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
29819, 0 hits in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Stau2, mouse
EvolutionaryTraceiQ8CJ67

Protein Ontology

More...
PROi
PR:Q8CJ67
RNActiQ8CJ67, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000025920, Expressed in brain and 305 other tissues
GenevisibleiQ8CJ67, MM

Family and domain databases

CDDicd19880, DSRM_STAU2_rpt1, 1 hit
cd19882, DSRM_STAU2_rpt2, 1 hit
cd19884, DSRM_STAU2_rpt3, 1 hit
cd19886, DSRM_STAU2_rpt4, 1 hit
InterProiView protein in InterPro
IPR014720, dsRBD_dom
IPR044476, STAU2_DSRM_1
IPR044464, STAU2_DSRM_2
IPR044473, STAU2_DSRM_3
IPR044474, STAU2_DSRM_4
IPR032478, Staufen_C
PfamiView protein in Pfam
PF00035, dsrm, 4 hits
PF16482, Staufen_C, 1 hit
SMARTiView protein in SMART
SM00358, DSRM, 4 hits
PROSITEiView protein in PROSITE
PS50137, DS_RBD, 4 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTAU2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CJ67
Secondary accession number(s): Q8BSY8
, Q8CJ66, Q8R175, Q91Z19, Q9D5N7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: March 1, 2003
Last modified: June 2, 2021
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again