Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (26 Feb 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Deleted in malignant brain tumors 1 protein

Gene

Dmbt1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play roles in mucosal defense system, cellular immune defense and epithelial differentiation (By similarity). May play a role in liver regeneration. May be an important factor in fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. May function as a binding protein in saliva for the regulation of taste sensation. May play a role as an opsonin receptor for SFTPD and SPAR in macrophages tissues throughout the body, including epithelial cells lining the gastrointestinal tract (By similarity). Required for terminal differentiation of columnar epithelial cells during early embryogenesis. Displays a broad calcium-dependent binding spectrum against both Gram-positive and Gram-negative bacteria, suggesting a role in defense against bacterial pathogens. Binds to a range of poly-sulfated and poly-phosphorylated ligands which may explain its broad bacterial-binding specificity. Inhibits cytoinvasion of S.enterica. Associates with the actin cytoskeleton and is involved in its remodeling during regulated exocytosis. Interacts with pancreatic zymogens in a pH-dependent manner and may act as a Golgi cargo receptor in the regulated secretory pathway of the pancreatic acinar cell (By similarity).By similarity3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Protein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Deleted in malignant brain tumors 1 protein
Alternative name(s):
Ebnerin
Hensin
Pancrin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dmbt1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
61984 Dmbt1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1383 – 1403HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004538920 – 1418Deleted in malignant brain tumors 1 proteinAdd BLAST1399

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi130 ↔ 194By similarity
Disulfide bondi143 ↔ 204By similarity
Disulfide bondi174 ↔ 184By similarity
Disulfide bondi298 ↔ 362By similarity
Disulfide bondi311 ↔ 372By similarity
Disulfide bondi342 ↔ 352By similarity
Disulfide bondi445 ↔ 509By similarity
Disulfide bondi458 ↔ 519By similarity
Disulfide bondi489 ↔ 499By similarity
Disulfide bondi574 ↔ 600By similarity
Disulfide bondi625 ↔ 647By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi638N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi639N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi651N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi711 ↔ 737By similarity
Disulfide bondi762 ↔ 784By similarity
Glycosylationi776N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi788N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi838N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi848N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi882 ↔ 943By similarity
Disulfide bondi913 ↔ 923By similarity
Glycosylationi963N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi966 ↔ 992By similarity
Disulfide bondi1017 ↔ 1039By similarity
Glycosylationi1078N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1079N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1115N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1146N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1150N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1191N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1207N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1253 ↔ 1311By similarity
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1406PhosphothreonineBy similarity1
Modified residuei1415PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Highly N- and O-glycosylated. The O-glycans are heavily sulfated (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
Q8CIZ5

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8CIZ5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in von Ebner glands (VEG) (at protein level), olfactory epithelium and the lateral nasal gland. Expressed in transit-amplifying ductular (oval) cells. Up-regulated at day 3 after hepatectomy. Expressed in newly formed bile ducts and in structures resembling intestinal epithelium.2 Publications

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds SFTPD and SPAR in a calcium-dependent manner (By similarity).

Interacts with LGALS3.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000027919

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8CIZ5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini70 – 170SRCR 1PROSITE-ProRule annotationAdd BLAST101
Domaini105 – 205SRCR 2PROSITE-ProRule annotationAdd BLAST101
Domaini273 – 373SRCR 3PROSITE-ProRule annotationAdd BLAST101
Domaini420 – 520SRCR 4PROSITE-ProRule annotationAdd BLAST101
Domaini574 – 683CUB 1PROSITE-ProRule annotationAdd BLAST110
Domaini711 – 820CUB 2PROSITE-ProRule annotationAdd BLAST110
Domaini844 – 944SRCR 5PROSITE-ProRule annotationAdd BLAST101
Domaini966 – 1075CUB 3PROSITE-ProRule annotationAdd BLAST110
Domaini1084 – 1332ZPPROSITE-ProRule annotationAdd BLAST249

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi524 – 567Thr-richAdd BLAST44

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SRCR domains mediate binding to bacteria.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DMBT1 family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8CIZ5

KEGG Orthology (KO)

More...
KOi
K13912

Database of Orthologous Groups

More...
OrthoDBi
1095487at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8CIZ5

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00041 CUB, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.290, 3 hits
3.10.250.10, 5 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000859 CUB_dom
IPR035914 Sperma_CUB_dom_sf
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
IPR001507 ZP_dom
IPR017977 ZP_dom_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00431 CUB, 3 hits
PF00530 SRCR, 4 hits
PF00100 Zona_pellucida, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00258 SPERACTRCPTR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00042 CUB, 3 hits
SM00202 SR, 4 hits
SM00241 ZP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49854 SSF49854, 3 hits
SSF56487 SSF56487, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01180 CUB, 3 hits
PS00420 SRCR_1, 2 hits
PS50287 SRCR_2, 5 hits
PS00682 ZP_1, 1 hit
PS51034 ZP_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8CIZ5-1) [UniParc]FASTAAdd to basket
Also known as: Dmbt1 4.7kb

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGISIVIFEI CLLWGQILST ASQSRSSTPD WWNHGGTIND VIYDTQETPE
60 70 80 90 100
VTTTQVPDST SIGTDSGLAV RLVNGGDRCR GRVEILYQGS WGTMCDDGTD
110 120 130 140 150
SGLAVRLVNG GDRCRGRVEI LYQGSWGTMC DDSWDINDAN VVCRQLGCGW
160 170 180 190 200
ALSAPGSAQF GQGLGPIVLD DVACRGHEAY LWSCSHRGWL SHNCGHQEDA
210 220 230 240 250
GVICSDSQTS SPTPGWWNPG GTNNDVIYDT QETTETSQTS SPTPDWWNHG
260 270 280 290 300
GTINDVIYDT QETTEGTDSG LAVRLVNGGD RCRGRVEILY QGSWGTVCDD
310 320 330 340 350
SWDINDANVV CRQLGCGWAL SAPGSAQFGQ GSGSIVLDDV ACRGHEAYLW
360 370 380 390 400
SCSHRGWLSH NCGHQEDAGV ICSYSQTSSP TPDSQTSSPT PGWWNPGGTN
410 420 430 440 450
NDVSYGPEQT TDATDSGLAV RLVNGGDRCQ GRVEILYQGS WGTVCDDSWD
460 470 480 490 500
TKDANVVCRQ LVCGWALSAP GSAHFGQGSG SIVLDDVACT GHEAYLWSCS
510 520 530 540 550
HRGWLSHNCG HHEDAGVICS DAQTQSTTWP DMWPTTTPET TTDWWTTKYS
560 570 580 590 600
SSVPTTQFPT IADWWTTPSP EYTCGGLLTL PYGQFSSPYY PGSYPNNARC
610 620 630 640 650
LWKIFVSSMN RVTVVFTDVQ LEGGCNYDYI LVFDGPENNS SLIARVCDGF
660 670 680 690 700
NGSFTSTQNF MSVVFITDGS VTRRGFQADY YSTPISTSTT SPTTFPIVTD
710 720 730 740 750
WWTTPSPEYT CGGLLTLPYG QFSSPYYPGS YPNNARCLWK IFVPSMNRVT
760 770 780 790 800
VVFTDVQLEG GCNYDYILGF DGPEYNSSLI ARVCDGSNGS FTSTQNFMSV
810 820 830 840 850
VFITDGSVTR RGFQADYYST PIRTSTTPPT TFPIITGNDS SLVLRLVNGT
860 870 880 890 900
NRCEGRVEIL YRGSWVPCAD DSWDINDANV VCRQLGCGSA LSAPGNAWFG
910 920 930 940 950
QGSGLIVLDD VSCSGYESHL WNCRHPGWLV HNCRHVEDAG VICSLPDPTP
960 970 980 990 1000
SPGPVWTSPP FVNYTCGGFL TGLSGQFSSP YYPGSYPNNA RCLWNIEVPN
1010 1020 1030 1040 1050
NYRVTVVFRD VQLEGGCNYD YIEIFDGPHH SSPLIARVCD GAMGSFTSTS
1060 1070 1080 1090 1100
NFMSVRFTTD HSVTRRGFRA DYYSDFDNNT TNLLCLSNHM RASVSRSYLQ
1110 1120 1130 1140 1150
SMGYSSRDLV IPGWNVSYQC QPQITQREVI FTIPYTGCGT TKQADNETIN
1160 1170 1180 1190 1200
YSNFLKAAVS NGIIKRRKDL HIHVSCKMLQ NTWVNTMYIT NNTVEIQEVQ
1210 1220 1230 1240 1250
YGNFDVNISF YTSSSFLYPV TSSPYYVDLD QNLYLQAEVL HSDTSLALFV
1260 1270 1280 1290 1300
DTCVASPHPN DFSSLTYDLI RSGCIRDETY QSYSSPSPRI TRFKFSSFHF
1310 1320 1330 1340 1350
LNRFPSVYLQ CKLVVCRAND VSSRCYRGCV VRSKRDVGSY QEKVDVVLGP
1360 1370 1380 1390 1400
IQLQSPSKEK RSLDLAVADV EKPASSQEVY PTAAIFGGVF LALVVAVAAF
1410
TLGRKTRTAR GQPPSTKM
Length:1,418
Mass (Da):155,720
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1034F44C7465C2E8
GO
Isoform 2 (identifier: Q8CIZ5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-97: Missing.
     375-375: S → SPTSSPTPGWWNPGFTNSDVSYRTELPTDDS
     827-837: TPPTTFPIITG → R
     866-871: VPCADD → GTVCDN
     955-961: Missing.

Show »
Length:1,396
Mass (Da):153,478
Checksum:i52A1DFEBE4BF1E68
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC52248 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti129M → V in AAS46613 (Ref. 2) Curated1
Sequence conflicti164 – 166LGP → SGS in AAS46613 (Ref. 2) Curated3
Sequence conflicti343R → T in AAS46613 (Ref. 2) Curated1
Sequence conflicti462V → G in AAS46613 (Ref. 2) Curated1
Sequence conflicti638N → Y in AAS46613 (Ref. 2) Curated1
Sequence conflicti769G → V in AAS46613 (Ref. 2) Curated1
Sequence conflicti1058T → I in AAS46613 (Ref. 2) Curated1
Sequence conflicti1106S → A in AAS46613 (Ref. 2) Curated1
Sequence conflicti1319N → Y in AAS46613 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01685463 – 97Missing in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_016855375S → SPTSSPTPGWWNPGFTNSDV SYRTELPTDDS in isoform 2. 1 Publication1
Alternative sequenceiVSP_016856827 – 837TPPTTFPIITG → R in isoform 2. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_016857866 – 871VPCADD → GTVCDN in isoform 2. 1 Publication6
Alternative sequenceiVSP_016858955 – 961Missing in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF540887 mRNA Translation: AAN16473.1
AY548057 mRNA Translation: AAS46613.1
U32681 mRNA Translation: AAC52248.1 Different initiation.

Protein sequence database of the Protein Information Resource

More...
PIRi
A57190

NCBI Reference Sequences

More...
RefSeqi
NP_074040.2, NM_022849.3 [Q8CIZ5-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
170568

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:170568

UCSC genome browser

More...
UCSCi
RGD:61984 rat [Q8CIZ5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF540887 mRNA Translation: AAN16473.1
AY548057 mRNA Translation: AAS46613.1
U32681 mRNA Translation: AAC52248.1 Different initiation.
PIRiA57190
RefSeqiNP_074040.2, NM_022849.3 [Q8CIZ5-1]

3D structure databases

SMRiQ8CIZ5
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000027919

PTM databases

PhosphoSitePlusiQ8CIZ5

Proteomic databases

PRIDEiQ8CIZ5

Genome annotation databases

GeneIDi170568
KEGGirno:170568
UCSCiRGD:61984 rat [Q8CIZ5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1755
RGDi61984 Dmbt1

Phylogenomic databases

InParanoidiQ8CIZ5
KOiK13912
OrthoDBi1095487at2759
PhylomeDBiQ8CIZ5

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q8CIZ5

Family and domain databases

CDDicd00041 CUB, 3 hits
Gene3Di2.60.120.290, 3 hits
3.10.250.10, 5 hits
InterProiView protein in InterPro
IPR000859 CUB_dom
IPR035914 Sperma_CUB_dom_sf
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
IPR001507 ZP_dom
IPR017977 ZP_dom_CS
PfamiView protein in Pfam
PF00431 CUB, 3 hits
PF00530 SRCR, 4 hits
PF00100 Zona_pellucida, 1 hit
PRINTSiPR00258 SPERACTRCPTR
SMARTiView protein in SMART
SM00042 CUB, 3 hits
SM00202 SR, 4 hits
SM00241 ZP, 1 hit
SUPFAMiSSF49854 SSF49854, 3 hits
SSF56487 SSF56487, 5 hits
PROSITEiView protein in PROSITE
PS01180 CUB, 3 hits
PS00420 SRCR_1, 2 hits
PS50287 SRCR_2, 5 hits
PS00682 ZP_1, 1 hit
PS51034 ZP_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDMBT1_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CIZ5
Secondary accession number(s): Q62827, Q6QD54
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: March 1, 2003
Last modified: February 26, 2020
This is version 122 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again