Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (29 Sep 2021)
Sequence version 4 (27 Jul 2011)
Previous versions | rss
Add a publicationFeedback
Protein

PDZ and LIM domain protein 5

Gene

Pdlim5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play an important role in the heart development by scaffolding PKC to the Z-disk region. Isoform 2 and isoform 3 may negatively modulate the scaffolding activity of isoform 1. May play a role in the regulation of cardiomyocyte expansion. Overexpression promotes the development of heart hypertrophy. Contributes to the regulation of dendritic spine morphogenesis in neurons. May restrain postsynaptic growth of excitatory synapses (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PDZ and LIM domain protein 5
Alternative name(s):
Enigma homolog
Enigma-like PDZ and LIM domains protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pdlim5
Synonyms:Enh
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1927489, Pdlim5

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000028273

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758782 – 591PDZ and LIM domain protein 5Add BLAST590

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei2PhosphoserineBy similarity1
Modified residuei89N6-acetyllysine; alternateCombined sources1
Modified residuei89N6-succinyllysine; alternateCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki89Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residuei111PhosphoserineBy similarity1
Modified residuei134PhosphoserineBy similarity1
Modified residuei137PhosphoserineBy similarity1
Modified residuei228PhosphoserineCombined sources1
Modified residuei260PhosphoserineBy similarity1
Modified residuei313PhosphoserineBy similarity1
Modified residuei322PhosphoserineBy similarity1
Modified residuei350N6-acetyllysineCombined sources1
Modified residuei359PhosphoserineBy similarity1
Modified residuei361PhosphoserineBy similarity1
Isoform 3 (identifier: Q8CI51-3)
Modified residuei102PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei218PhosphoserineCombined sources1
Isoform 2 (identifier: Q8CI51-2)
Modified residuei316PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q8CI51

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8CI51

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8CI51

PeptideAtlas

More...
PeptideAtlasi
Q8CI51

PRoteomics IDEntifications database

More...
PRIDEi
Q8CI51

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
288087 [Q8CI51-1]
288088 [Q8CI51-2]
288089 [Q8CI51-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8CI51

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8CI51

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q8CI51

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028273, Expressed in heart and 307 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8CI51, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with various PKC isoforms through the LIM domains.

Interacts (via LIM domains) with SIPA1L1.

Interacts (via PDZ domain) with actin and ACTN1 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
207938, 104 interactors

Protein interaction database and analysis system

More...
IntActi
Q8CI51, 26 interactors

Molecular INTeraction database

More...
MINTi
Q8CI51

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000029941

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8CI51, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1591
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q8CI51

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8CI51

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q8CI51

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2 – 85PDZPROSITE-ProRule annotationAdd BLAST84
Domaini413 – 472LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini472 – 531LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60
Domaini531 – 591LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST61

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni121 – 166DisorderedSequence analysisAdd BLAST46
Regioni186 – 398DisorderedSequence analysisAdd BLAST213

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi135 – 165Polar residuesSequence analysisAdd BLAST31
Compositional biasi186 – 235Polar residuesSequence analysisAdd BLAST50
Compositional biasi238 – 274Basic and acidic residuesSequence analysisAdd BLAST37
Compositional biasi275 – 334Polar residuesSequence analysisAdd BLAST60
Compositional biasi352 – 398Polar residuesSequence analysisAdd BLAST47

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1703, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155292

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_038114_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8CI51

Identification of Orthologs from Complete Genome Data

More...
OMAi
ADQCSSA

Database of Orthologous Groups

More...
OrthoDBi
1013114at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8CI51

TreeFam database of animal gene trees

More...
TreeFami
TF106408

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031847, DUF4749
IPR001478, PDZ
IPR036034, PDZ_sf
IPR001781, Znf_LIM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15936, DUF4749, 1 hit
PF00412, LIM, 3 hits
PF00595, PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132, LIM, 3 hits
SM00228, PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156, SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 3 hits
PS50106, PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8CI51-1) [UniParc]FASTAAdd to basket
Also known as: ENH1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSNYSVSLVG PAPWGFRLQG GKDFNMPLTI SSLKDGGKAS QAHVRIGDVV
60 70 80 90 100
LSIDGISAQG MTHLEAQNKI KACTGSLNMT LQRASAAAKS EPVSVQKGEP
110 120 130 140 150
KEVVKPVPIT SPAVSKVTST TNMAYNKAPR PFGSVSSPKV TSIPSPSSAF
160 170 180 190 200
TPAHAATSSH ASPTPVAAAT PLHLSASGLH VSANLSADQC SSPPNTGKPA
210 220 230 240 250
VNVPRQPTVT SVCSESAQEL AEGQRRGSQG DIKQQNGPPR KHIVERNTEF
260 270 280 290 300
YHIPTHSDAS KKRLIEDTED WRPRTGTTQS RSFRILAQIT GTEHLTESEN
310 320 330 340 350
DNTKKANSTQ EPSQQPASSG ASPLSASEGP ESPGSSRPSV AGLRSAAAFK
360 370 380 390 400
PVGSTSVKSP SWQRPNQAAP STGRISNNAR SSGTGASVGP PQPSDQDTLV
410 420 430 440 450
QRAEHIPAGK RTPMCAHCNQ VIRGPFLVAL GKSWHPEEFN CAHCKNTMAY
460 470 480 490 500
IGFVEEKGAL YCELCYEKFF APECGRCQRK ILGEVINALK QTWHVSCFVC
510 520 530 540 550
VACGKPIRNN VFHLEDGEPY CETDYYALFG TICRGCEFPI EAGDMFLEAL
560 570 580 590
GYTWHDTCFV CSVCCESLEG QTFFSKKDKP LCKKHAHSVN F
Length:591
Mass (Da):63,299
Last modified:July 27, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE12B9EE1A3D97DC1
GO
Isoform 2 (identifier: Q8CI51-2) [UniParc]FASTAAdd to basket
Also known as: ENH2

The sequence of this isoform differs from the canonical sequence as follows:
     307-337: NSTQEPSQQPASSGASPLSASEGPESPGSSR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-591: Missing.

Show »
Length:337
Mass (Da):36,070
Checksum:iDDDBB44EFD25300F
GO
Isoform 3 (identifier: Q8CI51-3) [UniParc]FASTAAdd to basket
Also known as: ENH3

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GNPGTVKISPKR
     307-337: NSTQEPSQQPASSGASPLSASEGPESPGSSR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-591: Missing.

Show »
Length:239
Mass (Da):26,346
Checksum:i83FF76D9DA4FBFD8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D9J302D9J302_MOUSE
ENH isoform 1e
Pdlim5
614Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D9J2Z9D9J2Z9_MOUSE
ENH isoform 1b
Pdlim5
482Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D9J300D9J300_MOUSE
ENH isoform 1c
Pdlim5
526Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D9J301D9J301_MOUSE
ENH isoform 1d
Pdlim5
574Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JEJ0A0A0G2JEJ0_MOUSE
PDZ and LIM domain protein 5
Pdlim5
253Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JGZ5A0A0G2JGZ5_MOUSE
PDZ and LIM domain protein 5
Pdlim5
223Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D9J303D9J303_MOUSE
ENH isoform 3a
Pdlim5
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q8P5E9Q8P5_MOUSE
PDZ and LIM domain protein 5
Pdlim5
239Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WJI6F8WJI6_MOUSE
PDZ and LIM domain protein 5
Pdlim5
239Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9CRA2Q9CRA2_MOUSE
PDZ and LIM domain protein 5
Pdlim5
214Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti74T → M in AAH37476 (PubMed:15489334).Curated1
Sequence conflicti84A → T in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti84A → T in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti215E → D in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti215E → D in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti222E → K in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti222E → K in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti226R → K in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti226R → K in BAA88829 (PubMed:10833443).Curated1
Sequence conflicti329G → R in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti433S → P in BAA88827 (PubMed:10833443).Curated1
Sequence conflicti546F → Y in BAA88827 (PubMed:10833443).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01046798 – 206Missing in isoform 3. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_010468237G → GNPGTVKISPKR in isoform 3. 1 Publication1
Alternative sequenceiVSP_010469307 – 337NSTQE…PGSSR → KEKIPLHVFSPKYTKLRDWH HEVSARALNVQ in isoform 2 and isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_010470338 – 591Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST254

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB016586 mRNA Translation: BAA88827.1
AB016587 mRNA Translation: BAA88828.1
AB016588 mRNA Translation: BAA88829.1
AK147999 mRNA Translation: BAE28279.1
BC037476 mRNA Translation: AAH37476.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS17875.1 [Q8CI51-1]
CCDS17876.1 [Q8CI51-2]
CCDS38656.1 [Q8CI51-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001177781.1, NM_001190852.1
NP_001177783.1, NM_001190854.1
NP_001177784.1, NM_001190855.1
NP_001177785.1, NM_001190856.1
NP_062782.2, NM_019808.3 [Q8CI51-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000029941; ENSMUSP00000029941; ENSMUSG00000028273 [Q8CI51-1]
ENSMUST00000196908; ENSMUSP00000143098; ENSMUSG00000028273 [Q8CI51-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56376

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:56376

UCSC genome browser

More...
UCSCi
uc008rol.2, mouse [Q8CI51-1]
uc008ron.2, mouse [Q8CI51-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB016586 mRNA Translation: BAA88827.1
AB016587 mRNA Translation: BAA88828.1
AB016588 mRNA Translation: BAA88829.1
AK147999 mRNA Translation: BAE28279.1
BC037476 mRNA Translation: AAH37476.1
CCDSiCCDS17875.1 [Q8CI51-1]
CCDS17876.1 [Q8CI51-2]
CCDS38656.1 [Q8CI51-3]
RefSeqiNP_001177781.1, NM_001190852.1
NP_001177783.1, NM_001190854.1
NP_001177784.1, NM_001190855.1
NP_001177785.1, NM_001190856.1
NP_062782.2, NM_019808.3 [Q8CI51-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WF7NMR-A5-94[»]
BMRBiQ8CI51
SMRiQ8CI51
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi207938, 104 interactors
IntActiQ8CI51, 26 interactors
MINTiQ8CI51
STRINGi10090.ENSMUSP00000029941

PTM databases

iPTMnetiQ8CI51
PhosphoSitePlusiQ8CI51
SwissPalmiQ8CI51

Proteomic databases

EPDiQ8CI51
jPOSTiQ8CI51
PaxDbiQ8CI51
PeptideAtlasiQ8CI51
PRIDEiQ8CI51
ProteomicsDBi288087 [Q8CI51-1]
288088 [Q8CI51-2]
288089 [Q8CI51-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
4614, 401 antibodies

The DNASU plasmid repository

More...
DNASUi
56376

Genome annotation databases

EnsembliENSMUST00000029941; ENSMUSP00000029941; ENSMUSG00000028273 [Q8CI51-1]
ENSMUST00000196908; ENSMUSP00000143098; ENSMUSG00000028273 [Q8CI51-2]
GeneIDi56376
KEGGimmu:56376
UCSCiuc008rol.2, mouse [Q8CI51-1]
uc008ron.2, mouse [Q8CI51-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10611
MGIiMGI:1927489, Pdlim5
VEuPathDBiHostDB:ENSMUSG00000028273

Phylogenomic databases

eggNOGiKOG1703, Eukaryota
GeneTreeiENSGT00940000155292
HOGENOMiCLU_038114_0_1_1
InParanoidiQ8CI51
OMAiADQCSSA
OrthoDBi1013114at2759
PhylomeDBiQ8CI51
TreeFamiTF106408

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
56376, 1 hit in 61 CRISPR screens
EvolutionaryTraceiQ8CI51

Protein Ontology

More...
PROi
PR:Q8CI51
RNActiQ8CI51, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028273, Expressed in heart and 307 other tissues
GenevisibleiQ8CI51, MM

Family and domain databases

Gene3Di2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR031847, DUF4749
IPR001478, PDZ
IPR036034, PDZ_sf
IPR001781, Znf_LIM
PfamiView protein in Pfam
PF15936, DUF4749, 1 hit
PF00412, LIM, 3 hits
PF00595, PDZ, 1 hit
SMARTiView protein in SMART
SM00132, LIM, 3 hits
SM00228, PDZ, 1 hit
SUPFAMiSSF50156, SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 3 hits
PS50106, PDZ, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDLI5_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CI51
Secondary accession number(s): Q3UGD0
, Q9QYN0, Q9QYN1, Q9QYN2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: July 27, 2011
Last modified: September 29, 2021
This is version 163 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again