Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (22 Apr 2020)
Sequence version 2 (19 Jan 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rab11 family-interacting protein 3

Gene

Rab11fip3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a regulator of endocytic traffic by participating in membrane delivery. Required for the abcission step in cytokinesis, possibly by acting as an 'address tag' delivering recycling endosome membranes to the cleavage furrow during late cytokinesis (By similarity). Also required for the structural integrity of the endosomal recycling compartment during interphase. Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track) (By similarity).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi509 – 5201PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi541 – 5522PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5620916 VxPx cargo-targeting to cilium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab11 family-interacting protein 3
Short name:
FIP3-Rab11
Short name:
Rab11-FIP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rab11fip3
Synonyms:Kiaa0665
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2444431 Rab11fip3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Endosome, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003909701 – 1047Rab11 family-interacting protein 3Add BLAST1047

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei641PhosphoserineBy similarity1
Modified residuei765PhosphoserineCombined sources1
Modified residuei829PhosphoserineBy similarity1
Modified residuei938PhosphoserineBy similarity1
Modified residuei939PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8CHD8

PRoteomics IDEntifications database

More...
PRIDEi
Q8CHD8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8CHD8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8CHD8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037098 Expressed in adult mammalian kidney and 232 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8CHD8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8CHD8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Forms a complex with Rab11 (RAB11A or RAB11B) and ARF6.

Interacts with RAB11A; the interaction is direct.

Interacts with RAB11B, RAB25 and RAB11FIP4.

Interacts with ARF6.

Interacts with RACGAP1/MgcRacGAP; interaction takes place during late stage of cytokinesis and is required for recruitment to the midbody.

Interacts with EXOC7 (By similarity).

Interacts with ASAP1 (PubMed:18685082).

Interacts with dynein intermediate chain and dynactin (DCTN1) (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
229626, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000113521

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8CHD8 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8CHD8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini496 – 531EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini528 – 563EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini985 – 1047FIP-RBDPROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni775 – 879ARF-binding domain (ABD)By similarityAdd BLAST105

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili750 – 985Sequence analysisAdd BLAST236

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi37 – 451Glu-richAdd BLAST415

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RBD-FIP domain mediates the interaction with Rab11 (RAB11A or RAB11B).By similarity

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0982 Eukaryota
ENOG4111K32 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00440000033742

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018925_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8CHD8

KEGG Orthology (KO)

More...
KOi
K12485

Identification of Orthologs from Complete Genome Data

More...
OMAi
LVHHEMH

Database of Orthologous Groups

More...
OrthoDBi
1419449at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8CHD8

TreeFam database of animal gene trees

More...
TreeFami
TF327221

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00051 EFh, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR037245 FIP-RBD_C_sf
IPR019018 Rab-bd_FIP-RBD
IPR032920 Rab11-FIP3

The PANTHER Classification System

More...
PANTHERi
PTHR15726:SF6 PTHR15726:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09457 RBD-FIP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF144270 SSF144270, 1 hit
SSF47473 SSF47473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50222 EF_HAND_2, 2 hits
PS51511 FIP_RBD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q8CHD8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELCQPTSLS DHDQPASGPQ RGVMGLVGPD APRGWSEEPE EHAQLQRWPE
60 70 80 90 100
GPNAPICWPE EVEEPHAPSR WAKEPNAPRC SSQEPDESCH LAEELEESDS
110 120 130 140 150
PRCWPQEPDT PCHLAKELEE PDAPRCLPQE PDTPCYLAKE LEEPNIPRCW
160 170 180 190 200
PQEPDVPCHL AKELEEPDAP RCWPQEPDAF CHLLKEVEEP DALRCWLQGP
210 220 230 240 250
DAPCHLAKEL EDLDSPRCWP QEPDESCHLA KELEEPDAPC HLAKELEEPD
260 270 280 290 300
APRCWPQEPD VPCLLAKKWE ESDAPCLLTE ELEEPDALHC WPQESEAPCL
310 320 330 340 350
LAKELEEPDA SHSCPQEADT GCLSAKEPEE PDVSHLWQGV PDAPCLLVKE
360 370 380 390 400
PEEADALHCC WPEESEEPDA LNPPCFWANE PDEPDPSRCW SEEPQVLCLW
410 420 430 440 450
PEEQNTKRCW QEEPDAPCFW PEDREEPIVS CLQFKEPEKP KVRSSWPEEL
460 470 480 490 500
EDCCPTRGLP LEPLLADGEL LQACPGPPSD PGPALSLPSE PGTAQEEGAR
510 520 530 540 550
LRAVFDALDR DGDGFVRIED FIQFATVYGA EQVKDLTQYL DPSGLGVISF
560 570 580 590 600
EDFYQGIVAI RNGDPDGQLY SVEPVQDEET PACADEFDDF VTYEANEVTD
610 620 630 640 650
SAYMGSESTY SECETFTDED TSTLVHPELQ PEGDVDSAGG SGVPSECLDT
660 670 680 690 700
MEEPDHGALL LLPGRSRPHS QAVVMVIGSE EHFEDYGEGN EAELSPETLC
710 720 730 740 750
DGDGEDPAFL TPSPAKRLSS RKVARYLHQS GTLTMEALED PPPEPVECPE
760 770 780 790 800
EDIADKVIFL ERRVSELEKD SAAAGEQHGR LRQENLQLVH RANALEEQLK
810 820 830 840 850
EQEFRAQEKV LEETRKQKEL LCKMEREKSI EIENLQARLQ QLDEENSELR
860 870 880 890 900
SCTPCLKANI ERLEEEKQKM LDEIEELTQR LSEEQENKRK MGDRLSHERH
910 920 930 940 950
QFQRDKEATQ ELIEDLRKQL EHLQLLRLEV EQRRGRSSSL GLQEYNSRAR
960 970 980 990 1000
ESELEQEVRR LKQDNRNLKE QNDELNGQII TLSIQGAKSL FSTSFSESLA
1010 1020 1030 1040
AEISSVSRDE LMEAIQKQEE INFRLQDYID RIIVAILETN PSILEVK
Length:1,047
Mass (Da):118,535
Last modified:January 19, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4A78951AFB9696C4
GO
Isoform 2 (identifier: Q8CHD8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-603: Missing.

Show »
Length:444
Mass (Da):50,831
Checksum:i5B69706DD31E2A94
GO
Isoform 3 (identifier: Q8CHD8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     712-712: P → PSSNPLASKLCDVLTDEAFEFYCSQCHKQINRLEDLSARLTDLEMN

Show »
Length:1,092
Mass (Da):123,667
Checksum:iB33AF460152531B0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0386671 – 603Missing in isoform 2. 1 PublicationAdd BLAST603
Alternative sequenceiVSP_038668712P → PSSNPLASKLCDVLTDEAFE FYCSQCHKQINRLEDLSARL TDLEMN in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC140047 Genomic DNA No translation available.
AC159277 Genomic DNA No translation available.
BC023364 mRNA Translation: AAH23364.1
BC037132 mRNA Translation: AAH37132.1
AB093257 mRNA Translation: BAC41441.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS50039.1 [Q8CHD8-2]
CCDS50040.1 [Q8CHD8-1]
CCDS50041.1 [Q8CHD8-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001156340.1, NM_001162868.1 [Q8CHD8-1]
NP_001156341.1, NM_001162869.1 [Q8CHD8-3]
NP_694780.1, NM_153140.2 [Q8CHD8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000118828; ENSMUSP00000113048; ENSMUSG00000037098 [Q8CHD8-2]
ENSMUST00000120691; ENSMUSP00000112875; ENSMUSG00000037098 [Q8CHD8-1]
ENSMUST00000122103; ENSMUSP00000113521; ENSMUSG00000037098 [Q8CHD8-3]
ENSMUST00000148021; ENSMUSP00000119626; ENSMUSG00000037098 [Q8CHD8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
215445

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:215445

UCSC genome browser

More...
UCSCi
uc008bdc.2 mouse [Q8CHD8-2]
uc008bdd.2 mouse [Q8CHD8-3]
uc008bde.2 mouse [Q8CHD8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC140047 Genomic DNA No translation available.
AC159277 Genomic DNA No translation available.
BC023364 mRNA Translation: AAH23364.1
BC037132 mRNA Translation: AAH37132.1
AB093257 mRNA Translation: BAC41441.1
CCDSiCCDS50039.1 [Q8CHD8-2]
CCDS50040.1 [Q8CHD8-1]
CCDS50041.1 [Q8CHD8-3]
RefSeqiNP_001156340.1, NM_001162868.1 [Q8CHD8-1]
NP_001156341.1, NM_001162869.1 [Q8CHD8-3]
NP_694780.1, NM_153140.2 [Q8CHD8-2]

3D structure databases

SMRiQ8CHD8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi229626, 1 interactor
STRINGi10090.ENSMUSP00000113521

PTM databases

iPTMnetiQ8CHD8
PhosphoSitePlusiQ8CHD8

Proteomic databases

PaxDbiQ8CHD8
PRIDEiQ8CHD8

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22705 87 antibodies

Genome annotation databases

EnsembliENSMUST00000118828; ENSMUSP00000113048; ENSMUSG00000037098 [Q8CHD8-2]
ENSMUST00000120691; ENSMUSP00000112875; ENSMUSG00000037098 [Q8CHD8-1]
ENSMUST00000122103; ENSMUSP00000113521; ENSMUSG00000037098 [Q8CHD8-3]
ENSMUST00000148021; ENSMUSP00000119626; ENSMUSG00000037098 [Q8CHD8-2]
GeneIDi215445
KEGGimmu:215445
UCSCiuc008bdc.2 mouse [Q8CHD8-2]
uc008bdd.2 mouse [Q8CHD8-3]
uc008bde.2 mouse [Q8CHD8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9727
MGIiMGI:2444431 Rab11fip3

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG0982 Eukaryota
ENOG4111K32 LUCA
GeneTreeiENSGT00440000033742
HOGENOMiCLU_018925_2_0_1
InParanoidiQ8CHD8
KOiK12485
OMAiLVHHEMH
OrthoDBi1419449at2759
PhylomeDBiQ8CHD8
TreeFamiTF327221

Enzyme and pathway databases

ReactomeiR-MMU-5620916 VxPx cargo-targeting to cilium

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Rab11fip3 mouse

Protein Ontology

More...
PROi
PR:Q8CHD8
RNActiQ8CHD8 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037098 Expressed in adult mammalian kidney and 232 other tissues
ExpressionAtlasiQ8CHD8 baseline and differential
GenevisibleiQ8CHD8 MM

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
IPR037245 FIP-RBD_C_sf
IPR019018 Rab-bd_FIP-RBD
IPR032920 Rab11-FIP3
PANTHERiPTHR15726:SF6 PTHR15726:SF6, 2 hits
PfamiView protein in Pfam
PF09457 RBD-FIP, 1 hit
SUPFAMiSSF144270 SSF144270, 1 hit
SSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 2 hits
PS51511 FIP_RBD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRFIP3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CHD8
Secondary accession number(s): Q8JZT3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 19, 2010
Last sequence update: January 19, 2010
Last modified: April 22, 2020
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again