Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (13 Feb 2019)
Sequence version 2 (01 Jun 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Interleukin-1 receptor-associated kinase-like 2

Gene

Irak2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization.By similarity

Caution

Asn-333 is present instead of the conserved Asp which is expected to be an active site residue.Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei235ATPPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi214 – 222ATPPROSITE-ProRule annotation9
Nucleotide bindingi335 – 338ATPPROSITE-ProRule annotation4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-168638 NOD1/2 Signaling Pathway
R-MMU-445989 TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-MMU-9020702 Interleukin-1 signaling
R-MMU-937042 IRAK2 mediated activation of TAK1 complex
R-MMU-937072 TRAF6-mediated induction of TAK1 complex within TLR4 complex
R-MMU-975138 TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
R-MMU-975155 MyD88 dependent cascade initiated on endosome
R-MMU-975163 IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Interleukin-1 receptor-associated kinase-like 2
Short name:
IRAK-2
Short name:
mu-IRAK-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Irak2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2429603 Irak2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002775601 – 622Interleukin-1 receptor-associated kinase-like 2Add BLAST622

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8CFA1

PRoteomics IDEntifications database

More...
PRIDEi
Q8CFA1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8CFA1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8CFA1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, with a higher expression observed in brain, spleen and liver. Isoform 1 and isoform 2 are considered agonist and isoform 3 and isoform 4 are considered antagonist.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000060477 Expressed in 165 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8CFA1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8CFA1 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MYD88. IL-1 stimulation leads to the formation of a signaling complex which dissociates from the IL-1 receptor following the binding of PELI1 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
224495, 2 interactors

Database of interacting proteins

More...
DIPi
DIP-49685N

Protein interaction database and analysis system

More...
IntActi
Q8CFA1, 4 interactors

Molecular INTeraction database

More...
MINTi
Q8CFA1

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000055073

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q8CFA1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8CFA1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini13 – 94DeathAdd BLAST82
Domaini208 – 473Protein kinasePROSITE-ProRule annotationAdd BLAST266

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The protein kinase domain is predicted to be catalytically inactive.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1187 Eukaryota
COG0515 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159835

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG052145

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8CFA1

KEGG Orthology (KO)

More...
KOi
K04731

Identification of Orthologs from Complete Genome Data

More...
OMAi
IHISTVQ

Database of Orthologous Groups

More...
OrthoDBi
684563at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8CFA1

TreeFam database of animal gene trees

More...
TreeFami
TF328924

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR033611 IRAK2
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom

The PANTHER Classification System

More...
PANTHERi
PTHR24419:SF2 PTHR24419:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00531 Death, 1 hit
PF00069 Pkinase, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 1 hit
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8CFA1-1) [UniParc]FASTAAdd to basket
Also known as: IRAK-2a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MACYIYQLPS WVLDDLCRNI DTLSEWDWMQ FASYVITDLT QLRKIKSMER
60 70 80 90 100
VQGVSITREL LWWWSMRQAT VQQLVDLLCH LELYRAAQIV LSWKPVPEST
110 120 130 140 150
SPLPAFPEAV KPGAVATSRR NLKDEQEKVR PVKPRSLLDT GPIMAGAQRQ
160 170 180 190 200
RPCEMDAPCS LKTDAPDSPQ SKYCSTSTSA PKQERLLGLP GDRLFWSEAD
210 220 230 240 250
VVQATEDFDQ SHRISEGTFA DIYQGQRNGV AFAFKKLREV AGSSPGSMDR
260 270 280 290 300
FLQAEMQLCL RCCHANVLPL LGFCTGRQFH SLIYPYMANG SLHDRLWAQG
310 320 330 340 350
NSDMLPWPQR ASICSGLLLA VEHLHSLDII HSNVKSANVL LDQHLNPKLA
360 370 380 390 400
HPVAHPHPDN KKTKYTVMRT HLFQASAAYL PEHFIRVGQL TKQVDIFSCG
410 420 430 440 450
IVLAEVLTGI PAMDKDRSPV YLKDLLLSEI PNSTSSVCSR KTSMGKAVVK
460 470 480 490 500
EICQRHVEKR AGLLPEACEE AWATAVSVCL RRRNASVEEA RVSLAGVEEQ
510 520 530 540 550
LRGQLSLPWS RVSEATGSSS NTPEETDDVD NSSLSVPSLV MMASCPGAAS
560 570 580 590 600
SPLFTGHGAA QPSTSGRQEA DSSSEACTGP QTPQNATETS WKIEINEAKR
610 620
RLMENIVLYK EERLDSSELF GP
Length:622
Mass (Da):69,047
Last modified:June 1, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAD4692A0B6BFE733
GO
Isoform 2 (identifier: Q8CFA1-2) [UniParc]FASTAAdd to basket
Also known as: IRAK-2b

The sequence of this isoform differs from the canonical sequence as follows:
     94-141: Missing.

Show »
Length:574
Mass (Da):63,870
Checksum:iEFA629937D2F6335
GO
Isoform 3 (identifier: Q8CFA1-3) [UniParc]FASTAAdd to basket
Also known as: IRAK-2d

The sequence of this isoform differs from the canonical sequence as follows:
     32-93: ASYVITDLTQLRKIKSMERVQGVSITRELLWWWSMRQATVQQLVDLLCHLELYRAAQIVLSW → G
     490-499: Missing.

Show »
Length:551
Mass (Da):60,734
Checksum:iE4030CE5C6EB366A
GO
Isoform 4 (identifier: Q8CFA1-4) [UniParc]FASTAAdd to basket
Also known as: IRAK-2c

The sequence of this isoform differs from the canonical sequence as follows:
     1-143: Missing.

Show »
Length:479
Mass (Da):52,463
Checksum:iA029C4439FAC23D2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0N4SUW3A0A0N4SUW3_MOUSE
Interleukin-1 receptor-associated k...
Irak2
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti129V → A in BAE28437 (PubMed:16141072).Curated1
Sequence conflicti142 – 151PIMAGAQRQR → ALLPSFLLLF in BAC28438 (PubMed:16141072).Curated10
Sequence conflicti151R → V in BAC37114 (PubMed:16141072).Curated1
Sequence conflicti188 – 190GLP → SLH in BAE28437 (PubMed:16141072).Curated3
Sequence conflicti267V → I in BAE28437 (PubMed:16141072).Curated1
Sequence conflicti273F → V in BAE28437 (PubMed:16141072).Curated1
Sequence conflicti343Q → R in BAC37114 (PubMed:16141072).Curated1
Sequence conflicti345L → F in AAH85324 (PubMed:15489334).Curated1
Sequence conflicti438C → G in BAE28437 (PubMed:16141072).Curated1
Sequence conflicti448V → E in AAO24761 (PubMed:15082713).Curated1
Sequence conflicti448V → E in AAO24762 (PubMed:15082713).Curated1
Sequence conflicti448V → E in AAO24763 (PubMed:15082713).Curated1
Sequence conflicti448V → E in AAO24764 (PubMed:15082713).Curated1
Sequence conflicti459K → R in BAE28437 (PubMed:16141072).Curated1
Sequence conflicti509W → G in AAH85324 (PubMed:15489334).Curated1
Sequence conflicti535S → G in BAC26088 (PubMed:16141072).Curated1
Sequence conflicti554F → S in BAE28437 (PubMed:16141072).Curated1
Sequence conflicti585N → D in BAE28437 (PubMed:16141072).Curated1
Sequence conflicti599K → E in BAE28437 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0230251 – 143Missing in isoform 4. 2 PublicationsAdd BLAST143
Alternative sequenceiVSP_02302632 – 93ASYVI…IVLSW → G in isoform 3. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_02302794 – 141Missing in isoform 2. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_023028490 – 499Missing in isoform 3. 1 Publication10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ440756 mRNA Translation: CAD29447.2
AY162378 mRNA Translation: AAO24761.1
AY162379 mRNA Translation: AAO24762.1
AY162380 mRNA Translation: AAO24763.1
AY162381 mRNA Translation: AAO24764.1
AK028733 mRNA Translation: BAC26088.1
AK033707 mRNA Translation: BAC28438.1
AK078062 mRNA Translation: BAC37114.1
AK148248 mRNA Translation: BAE28437.1
AK150056 mRNA Translation: BAE29271.1
AK151428 mRNA Translation: BAE30392.1
AK152682 mRNA Translation: BAE31414.1
AK154715 mRNA Translation: BAE32783.1
BC085324 mRNA Translation: AAH85324.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20430.1 [Q8CFA1-1]
CCDS51873.1 [Q8CFA1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001107025.1, NM_001113553.1 [Q8CFA1-2]
NP_751893.3, NM_172161.4 [Q8CFA1-1]
XP_006505388.1, XM_006505325.3 [Q8CFA1-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.152142

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000059286; ENSMUSP00000055073; ENSMUSG00000060477 [Q8CFA1-1]
ENSMUST00000089022; ENSMUSP00000086416; ENSMUSG00000060477 [Q8CFA1-2]
ENSMUST00000089023; ENSMUSP00000086417; ENSMUSG00000060477 [Q8CFA1-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
108960

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:108960

UCSC genome browser

More...
UCSCi
uc009dhc.3 mouse [Q8CFA1-1]
uc009dhe.3 mouse [Q8CFA1-2]
uc012eqf.2 mouse [Q8CFA1-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ440756 mRNA Translation: CAD29447.2
AY162378 mRNA Translation: AAO24761.1
AY162379 mRNA Translation: AAO24762.1
AY162380 mRNA Translation: AAO24763.1
AY162381 mRNA Translation: AAO24764.1
AK028733 mRNA Translation: BAC26088.1
AK033707 mRNA Translation: BAC28438.1
AK078062 mRNA Translation: BAC37114.1
AK148248 mRNA Translation: BAE28437.1
AK150056 mRNA Translation: BAE29271.1
AK151428 mRNA Translation: BAE30392.1
AK152682 mRNA Translation: BAE31414.1
AK154715 mRNA Translation: BAE32783.1
BC085324 mRNA Translation: AAH85324.1
CCDSiCCDS20430.1 [Q8CFA1-1]
CCDS51873.1 [Q8CFA1-2]
RefSeqiNP_001107025.1, NM_001113553.1 [Q8CFA1-2]
NP_751893.3, NM_172161.4 [Q8CFA1-1]
XP_006505388.1, XM_006505325.3 [Q8CFA1-4]
UniGeneiMm.152142

3D structure databases

ProteinModelPortaliQ8CFA1
SMRiQ8CFA1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi224495, 2 interactors
DIPiDIP-49685N
IntActiQ8CFA1, 4 interactors
MINTiQ8CFA1
STRINGi10090.ENSMUSP00000055073

PTM databases

iPTMnetiQ8CFA1
PhosphoSitePlusiQ8CFA1

Proteomic databases

PaxDbiQ8CFA1
PRIDEiQ8CFA1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000059286; ENSMUSP00000055073; ENSMUSG00000060477 [Q8CFA1-1]
ENSMUST00000089022; ENSMUSP00000086416; ENSMUSG00000060477 [Q8CFA1-2]
ENSMUST00000089023; ENSMUSP00000086417; ENSMUSG00000060477 [Q8CFA1-3]
GeneIDi108960
KEGGimmu:108960
UCSCiuc009dhc.3 mouse [Q8CFA1-1]
uc009dhe.3 mouse [Q8CFA1-2]
uc012eqf.2 mouse [Q8CFA1-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3656
MGIiMGI:2429603 Irak2

Phylogenomic databases

eggNOGiKOG1187 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00940000159835
HOVERGENiHBG052145
InParanoidiQ8CFA1
KOiK04731
OMAiIHISTVQ
OrthoDBi684563at2759
PhylomeDBiQ8CFA1
TreeFamiTF328924

Enzyme and pathway databases

ReactomeiR-MMU-168638 NOD1/2 Signaling Pathway
R-MMU-445989 TAK1 activates NFkB by phosphorylation and activation of IKKs complex
R-MMU-9020702 Interleukin-1 signaling
R-MMU-937042 IRAK2 mediated activation of TAK1 complex
R-MMU-937072 TRAF6-mediated induction of TAK1 complex within TLR4 complex
R-MMU-975138 TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
R-MMU-975155 MyD88 dependent cascade initiated on endosome
R-MMU-975163 IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Irak2 mouse

Protein Ontology

More...
PROi
PR:Q8CFA1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000060477 Expressed in 165 organ(s), highest expression level in intestine
ExpressionAtlasiQ8CFA1 baseline and differential
GenevisibleiQ8CFA1 MM

Family and domain databases

InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR033611 IRAK2
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
PANTHERiPTHR24419:SF2 PTHR24419:SF2, 1 hit
PfamiView protein in Pfam
PF00531 Death, 1 hit
PF00069 Pkinase, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIRAK2_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CFA1
Secondary accession number(s): Q3U3K2
, Q3U7F5, Q3UFX2, Q5U404, Q6YBR8, Q6YBR9, Q6YBS0, Q6YBS1, Q8C5M0, Q8CC82, Q8CEA0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: June 1, 2003
Last modified: February 13, 2019
This is version 128 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again