Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (11 Dec 2019)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Dual specificity mitogen-activated protein kinase kinase 7

Gene

Map2k7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K4/MKK4, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4/MKK4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The monophosphorylation of JNKs on the Thr residue is sufficient to increase JNK activity indicating that MAP2K7/MKK7 is important to trigger JNK activity, while the additional phosphorylation of the Tyr residue by MAP2K4/MKK4 ensures optimal JNK activation. Has a specific role in JNK signal transduction pathway activated by proinflammatory cytokines. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Part of a non-canonical MAPK signaling pathway, composed of the upstream MAP3K12 kinase and downstream MAP kinases MAPK1/ERK2 and MAPK3/ERK1, that enhances the AP-1-mediated transcription of APP in response to APOE (PubMed:28111074).8 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by phosphorylation by specific MAP kinase kinase kinases such as MAP3K1/MEKK1, MAP3K3/MEKK3, MAP3K11/MLK3 and MAP3K12/DLK. Isoforms 3 and 4 have lower basal activity but a higher level of inducible activation, than isoforms 2, 6, 7 and 8.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei165ATPPROSITE-ProRule annotationBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei259Proton acceptorPROSITE-ProRule annotationBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi142 – 150ATPPROSITE-ProRule annotationBy similarity9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase, Tyrosine-protein kinase
Biological processApoptosis, Stress response
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.12.2 3474

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2559580 Oxidative Stress Induced Senescence
R-MMU-2871796 FCERI mediated MAPK activation
R-MMU-450321 JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dual specificity mitogen-activated protein kinase kinase 7 (EC:2.7.12.22 Publications)
Short name:
MAP kinase kinase 7
Short name:
MAPKK 7
Alternative name(s):
JNK-activating kinase 2
MAPK/ERK kinase 7
Short name:
MEK 7
c-Jun N-terminal kinase kinase 2
Short name:
JNK kinase 2
Short name:
JNKK 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Map2k7Imported
Synonyms:Mkk7Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1346871 Map2k7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002714062 – 535Dual specificity mitogen-activated protein kinase kinase 7Add BLAST534

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei287Phosphoserine; by MAP3KBy similarity1
Modified residuei291Phosphothreonine; by MAP3KBy similarity1
Modified residuei427PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Activated by phosphorylation on Ser-287 and Thr-291 by MAP kinase kinase kinases (MAP3Ks).1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei60 – 61Cleavage; by anthrax lethal factorBy similarity2
Sitei92 – 93Cleavage; by anthrax lethal factorBy similarity2

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8CE90

PeptideAtlas

More...
PeptideAtlasi
Q8CE90

PRoteomics IDEntifications database

More...
PRIDEi
Q8CE90

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8CE90

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8CE90

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high levels in brain, lung, liver, skeletal muscle, kidney, and testis and at lower levels in the heart and spleen.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at high levels in the brain, spinal cord, eyes, muscle, lungs, vertebrae, and intestine and at lower levels in the heart and livers at 12.5 dpc. At later stages of embryogenesis (14.5 dpc, 16.5 dpc, and 18.5 dpc) high levels were found in the brain, retina, bone marrow, skin, intestine, lung epithelium and the epithelial layers lining the olfactory cavity and developing teeth and whiskers.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000002948 Expressed in 286 organ(s), highest expression level in gonadal ridge

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8CE90 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8CE90 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RASSF7, the interaction promotes phosphorylation.

Interacts with VRK2 (By similarity).

Interacts (via its D domain) with its substrates MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3 (By similarity).

Interacts (via its DVD domain) with MAP3Ks activators like MAP3K5/ASK1 and MAP3K1/MEKK1 (By similarity).

Interacts with SH3RF1, MAPK8IP1/JIP1, MAPK8IP2/JIP2 and MAPK8IP3/JIP3 scaffold proteins.

Found in a complex with SH3RF1, RAC1, MAP3K11/MLK3, MAPK8IP1/JIP1 and MAPK8/JNK1 (PubMed:23963642).

Found in a complex with SH3RF1, RAC2, MAP3K7/TAK1, MAPK8IP1/JIP1, MAPK8/JNK1 and MAPK9/JNK2 (PubMed:27084103).

By similarity4 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
204954, 10 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q8CE90

Protein interaction database and analysis system

More...
IntActi
Q8CE90, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000003027

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8CE90 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8CE90

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini136 – 396Protein kinasePROSITE-ProRule annotationAdd BLAST261

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni37 – 73D domainBy similarityAdd BLAST37
Regioni393 – 416DVD domainBy similarityAdd BLAST24

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili2 – 30Sequence analysisAdd BLAST29

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DVD domain (residues 393-413) contains a conserved docking site and is found in the mammalian MAP kinase kinases (MAP2Ks). The DVD sites bind to their specific upstream MAP kinase kinase kinases (MAP3Ks) and are essential for activation.
The D domain (residues 37-73) contains a conserved docking site and is required for the binding to MAPK substrates.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0983 Eukaryota
ENOG410XTNQ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158914

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8CE90

KEGG Orthology (KO)

More...
KOi
K04431

Database of Orthologous Groups

More...
OrthoDBi
688282at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8CE90

TreeFam database of animal gene trees

More...
TreeFami
TF350701

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q8CE90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAASSLEQKL SRLEAKLKQE NREARRRIDL NLDISPQRPR PIIVITLSPA
60 70 80 90 100
PAPSQRAALQ LPLANDGGSR SPSSESSPQH PTPPTRPRHM LGLPSTLFTP
110 120 130 140 150
RSMESIEIDQ KLQEIMKQTG YLTIGGQRYQ AEINDLENLG EMGSGTCGQV
160 170 180 190 200
WKMRFRKTGH IIAVKQMRRS GNKEENKRIL MDLDVVLKSH DCPYIVQCFG
210 220 230 240 250
TFITNTDVFI AMELMGTCAE KLKKRMQGPI PERILGKMTV AIVKALYYLK
260 270 280 290 300
EKHGVIHRDV KPSNILLDER GQIKLCDFGI SGRLVDSKAK TRSAGCAAYM
310 320 330 340 350
APERIDPPDP TKPDYDIRAD VWSLGISLVE LATGQFPYKN CKTDFEVLTK
360 370 380 390 400
VLQEEPPLLP GHMGFSGDFQ SFVKDCLTKD HRKRPKYNKL LEHSFIKHYE
410 420 430 440 450
ILEVDVASWF KDVMAKTESP RTSGVLSQHH LPFFSTSVTW GAWPLAAQTP
460 470 480 490 500
FQSGVIRCRG RVPSPRRATG GSGGQPCVCA GGPGPSFTEM GPSPSPMLSN
510 520 530
TFFTPDPGAC PGASTWGLPR RRLCQLLTTS TPGCC
Length:535
Mass (Da):59,312
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA96DA75565E3CD0F
GO
Isoform 23 Publications (identifier: Q8CE90-2) [UniParc]FASTAAdd to basket
Also known as: a1 Publication, beta 11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     42-58: IIVITLSPAPAPSQRAA → T
     435-435: S → R
     436-535: Missing.

Show »
Length:419
Mass (Da):47,562
Checksum:iB12F5CE8364CE6F5
GO
Isoform 32 Publications (identifier: Q8CE90-3) [UniParc]FASTAAdd to basket
Also known as: alpha 21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: Missing.
     436-519: TSVTWGAWPL...CPGASTWGLP → GSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
     520-535: Missing.

Show »
Length:379
Mass (Da):42,725
Checksum:iD7CFD1B827C90015
GO
Isoform 41 Publication (identifier: Q8CE90-4) [UniParc]FASTAAdd to basket
Also known as: alpha 11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: Missing.
     435-435: S → R
     436-535: Missing.

Show »
Length:346
Mass (Da):39,377
Checksum:i15A41F9077C40EAB
GO
Isoform 51 Publication (identifier: Q8CE90-5) [UniParc]FASTAAdd to basket
Also known as: b1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: Missing.
     46-57: TLSPAPAPSQRA → MLTPFMPLVFNSP
     435-435: S → R
     436-535: Missing.

Show »
Length:391
Mass (Da):44,210
Checksum:i0ABA468DBB8255F7
GO
Isoform 63 Publications (identifier: Q8CE90-6) [UniParc]FASTAAdd to basket
Also known as: b1 Publication, gamma 11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     435-435: S → R
     436-535: Missing.

Show »
Length:435
Mass (Da):49,148
Checksum:iC88FDA908B97E34D
GO
Isoform 71 Publication (identifier: Q8CE90-7) [UniParc]FASTAAdd to basket
Also known as: gamma 21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     436-519: TSVTWGAWPL...CPGASTWGLP → GSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
     520-535: Missing.

Show »
Length:468
Mass (Da):52,497
Checksum:iA71A286EE0AF99FF
GO
Isoform 81 Publication (identifier: Q8CE90-8) [UniParc]FASTAAdd to basket
Also known as: beta 21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     42-58: IIVITLSPAPAPSQRAA → T
     436-519: TSVTWGAWPL...CPGASTWGLP → GSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
     520-535: Missing.

Show »
Length:452
Mass (Da):50,911
Checksum:i7243158357786C2A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A140LHN8A0A140LHN8_MOUSE
Dual-specificity mitogen-activated ...
Map2k7
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti47L → T in AAB63448 (PubMed:9891090).Curated1
Sequence conflicti166Q → K in BAC27272 (PubMed:16141072).Curated1
Sequence conflicti211A → V in AAC16274 (PubMed:9535930).Curated1
Sequence conflicti217T → I in AAB81848 (PubMed:9405446).Curated1
Sequence conflicti396I → II in AAD15819 (PubMed:9891090).Curated1
Sequence conflicti396I → II in AAD15821 (PubMed:9891090).Curated1
Sequence conflicti396I → II in AAD15823 (PubMed:9891090).Curated1
Sequence conflicti418E → D in AAB81848 (PubMed:9405446).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0522651 – 89Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_0522641 – 45Missing in isoform 5. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_05226642 – 58IIVIT…SQRAA → T in isoform 2 and isoform 8. 3 PublicationsAdd BLAST17
Alternative sequenceiVSP_05226746 – 57TLSPA…PSQRA → MLTPFMPLVFNSP in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_052268435S → R in isoform 2, isoform 4, isoform 5 and isoform 6. 5 Publications1
Alternative sequenceiVSP_052269436 – 535Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 5 PublicationsAdd BLAST100
Alternative sequenceiVSP_052270436 – 519TSVTW…TWGLP → GSLEESPTSPPSPKSFPLSP AIPQAQAEWVSGR in isoform 3, isoform 7 and isoform 8. 2 PublicationsAdd BLAST84
Alternative sequenceiVSP_052271520 – 535Missing in isoform 3, isoform 7 and isoform 8. 2 PublicationsAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF026216 mRNA Translation: AAB81848.1
U74463 mRNA Translation: AAC53364.1
U74464 mRNA Translation: AAC53365.1
AB005654 mRNA Translation: BAA24383.1
AF022112 mRNA Translation: AAC16274.1
AF022113 mRNA Translation: AAC16275.1
U93030 mRNA Translation: AAB63447.1
U93031 Genomic DNA Translation: AAB63448.1
AF060943 mRNA Translation: AAD15819.1
AF060944 mRNA Translation: AAD15820.1
AF060945 mRNA Translation: AAD15821.1
AF060946 mRNA Translation: AAD15822.1
AF060947 mRNA Translation: AAD15823.1
AK028772 mRNA Translation: BAC26111.1
AK031137 mRNA Translation: BAC27272.1
AK165184 mRNA Translation: BAE38066.1
BC070467 mRNA Translation: AAH70467.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40208.1 [Q8CE90-7]
CCDS40209.1 [Q8CE90-2]
CCDS52474.1 [Q8CE90-6]
CCDS80852.1 [Q8CE90-8]
CCDS80853.1 [Q8CE90-3]
CCDS80854.1 [Q8CE90-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001036022.1, NM_001042557.2 [Q8CE90-7]
NP_001157644.1, NM_001164172.1 [Q8CE90-6]
NP_001278706.1, NM_001291777.1 [Q8CE90-8]
NP_001278707.1, NM_001291778.1 [Q8CE90-3]
NP_001278712.1, NM_001291783.1 [Q8CE90-4]
NP_036074.2, NM_011944.3 [Q8CE90-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000003027; ENSMUSP00000003027; ENSMUSG00000002948 [Q8CE90-7]
ENSMUST00000062686; ENSMUSP00000054512; ENSMUSG00000002948 [Q8CE90-6]
ENSMUST00000110994; ENSMUSP00000106622; ENSMUSG00000002948 [Q8CE90-4]
ENSMUST00000110995; ENSMUSP00000106623; ENSMUSG00000002948 [Q8CE90-3]
ENSMUST00000110996; ENSMUSP00000106624; ENSMUSG00000002948 [Q8CE90-5]
ENSMUST00000110998; ENSMUSP00000106626; ENSMUSG00000002948 [Q8CE90-2]
ENSMUST00000110999; ENSMUSP00000106627; ENSMUSG00000002948 [Q8CE90-8]
ENSMUST00000145165; ENSMUSP00000117418; ENSMUSG00000109061 [Q8CE90-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26400

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:26400

UCSC genome browser

More...
UCSCi
uc009kti.2 mouse [Q8CE90-2]
uc009ktj.2 mouse [Q8CE90-6]
uc009ktk.2 mouse [Q8CE90-7]
uc009ktm.2 mouse [Q8CE90-4]
uc009ktn.2 mouse [Q8CE90-5]
uc057ake.1 mouse [Q8CE90-8]
uc057akf.1 mouse [Q8CE90-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF026216 mRNA Translation: AAB81848.1
U74463 mRNA Translation: AAC53364.1
U74464 mRNA Translation: AAC53365.1
AB005654 mRNA Translation: BAA24383.1
AF022112 mRNA Translation: AAC16274.1
AF022113 mRNA Translation: AAC16275.1
U93030 mRNA Translation: AAB63447.1
U93031 Genomic DNA Translation: AAB63448.1
AF060943 mRNA Translation: AAD15819.1
AF060944 mRNA Translation: AAD15820.1
AF060945 mRNA Translation: AAD15821.1
AF060946 mRNA Translation: AAD15822.1
AF060947 mRNA Translation: AAD15823.1
AK028772 mRNA Translation: BAC26111.1
AK031137 mRNA Translation: BAC27272.1
AK165184 mRNA Translation: BAE38066.1
BC070467 mRNA Translation: AAH70467.1
CCDSiCCDS40208.1 [Q8CE90-7]
CCDS40209.1 [Q8CE90-2]
CCDS52474.1 [Q8CE90-6]
CCDS80852.1 [Q8CE90-8]
CCDS80853.1 [Q8CE90-3]
CCDS80854.1 [Q8CE90-4]
RefSeqiNP_001036022.1, NM_001042557.2 [Q8CE90-7]
NP_001157644.1, NM_001164172.1 [Q8CE90-6]
NP_001278706.1, NM_001291777.1 [Q8CE90-8]
NP_001278707.1, NM_001291778.1 [Q8CE90-3]
NP_001278712.1, NM_001291783.1 [Q8CE90-4]
NP_036074.2, NM_011944.3 [Q8CE90-2]

3D structure databases

SMRiQ8CE90
ModBaseiSearch...

Protein-protein interaction databases

BioGridi204954, 10 interactors
CORUMiQ8CE90
IntActiQ8CE90, 2 interactors
STRINGi10090.ENSMUSP00000003027

PTM databases

iPTMnetiQ8CE90
PhosphoSitePlusiQ8CE90

Proteomic databases

PaxDbiQ8CE90
PeptideAtlasiQ8CE90
PRIDEiQ8CE90

Genome annotation databases

EnsembliENSMUST00000003027; ENSMUSP00000003027; ENSMUSG00000002948 [Q8CE90-7]
ENSMUST00000062686; ENSMUSP00000054512; ENSMUSG00000002948 [Q8CE90-6]
ENSMUST00000110994; ENSMUSP00000106622; ENSMUSG00000002948 [Q8CE90-4]
ENSMUST00000110995; ENSMUSP00000106623; ENSMUSG00000002948 [Q8CE90-3]
ENSMUST00000110996; ENSMUSP00000106624; ENSMUSG00000002948 [Q8CE90-5]
ENSMUST00000110998; ENSMUSP00000106626; ENSMUSG00000002948 [Q8CE90-2]
ENSMUST00000110999; ENSMUSP00000106627; ENSMUSG00000002948 [Q8CE90-8]
ENSMUST00000145165; ENSMUSP00000117418; ENSMUSG00000109061 [Q8CE90-1]
GeneIDi26400
KEGGimmu:26400
UCSCiuc009kti.2 mouse [Q8CE90-2]
uc009ktj.2 mouse [Q8CE90-6]
uc009ktk.2 mouse [Q8CE90-7]
uc009ktm.2 mouse [Q8CE90-4]
uc009ktn.2 mouse [Q8CE90-5]
uc057ake.1 mouse [Q8CE90-8]
uc057akf.1 mouse [Q8CE90-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5609
MGIiMGI:1346871 Map2k7

Phylogenomic databases

eggNOGiKOG0983 Eukaryota
ENOG410XTNQ LUCA
GeneTreeiENSGT00940000158914
InParanoidiQ8CE90
KOiK04431
OrthoDBi688282at2759
PhylomeDBiQ8CE90
TreeFamiTF350701

Enzyme and pathway databases

BRENDAi2.7.12.2 3474
ReactomeiR-MMU-2559580 Oxidative Stress Induced Senescence
R-MMU-2871796 FCERI mediated MAPK activation
R-MMU-450321 JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Map2k7 mouse

Protein Ontology

More...
PROi
PR:Q8CE90
RNActiQ8CE90 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000002948 Expressed in 286 organ(s), highest expression level in gonadal ridge
ExpressionAtlasiQ8CE90 baseline and differential
GenevisibleiQ8CE90 MM

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMP2K7_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CE90
Secondary accession number(s): O35406
, O35720, O35871, O35872, O54780, O70242, O70243, Q8BSP1, Q9QWG6, Q9R1Z3, Q9R1Z4, Q9R1Z5, Q9R1Z6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: March 1, 2003
Last modified: December 11, 2019
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again