Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (16 Oct 2019)
Sequence version 2 (18 Mar 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cyclin-D-binding Myb-like transcription factor 1

Gene

Dmtf1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest. May also cooperate with MYB to activate transcription of the ANPEP gene. Binds to the consensus sequence 5'-CCCG[GT]ATGT-3'.8 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi306 – 329H-T-H motifPROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processCell cycle, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-D-binding Myb-like transcription factor 1
Alternative name(s):
Cyclin-D-interacting Myb-like protein 1
Short name:
mDmp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dmtf1
Synonyms:Dmp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1344415 Dmtf1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice spontaneously develop tumors with a mean latency around 80 weeks. The most common tumor types are pulmonary adenomas, adenocarcinomas, hepatocellular tumors, B-cell lymphomas and vascular tumors. The protein appears to be haplo-insufficient for tumor suppression, as heterozygous animals are also prone to spontaneous tumor development. Mice lacking this protein also exhibit enhanced susceptibility to tumor induction by activated Ras or the application of dimethylbenzanthracene (DMBA) or ionizing radiation. Early passage murine embryonic fibroblasts (MEFs) from animals lacking this protein are susceptible to transformation by activated Ras alone due to functional inactivation of the ARF-p53 pathway. Late passage MEFs from animals lacking this protein escape senescence without disrupting CDKN2A/ARF or p53 function.3 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi319K → E: Abrogates DNA-binding. 2 Publications1

Keywords - Diseasei

Tumor suppressor

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003237301 – 761Cyclin-D-binding Myb-like transcription factor 1Add BLAST761

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8CE22

PRoteomics IDEntifications database

More...
PRIDEi
Q8CE22

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8CE22

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8CE22

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed (at mRNA level). Expressed in brain, intestine, kidney, lung, pancreas, skin, spleen and tongue (at protein level). Expressed at high levels in testis and thymus (at protein level). In all tissues examined, expression is predominant in non-proliferating and differentiated cell types. These include epithelial, interstitial and smooth muscle cells of the intestine, differentiated spermatids, sperm and interstitial cells of the testis, and lymphoid cells of the medullary compartment of the thymus.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed throughout the cell cycle. Expression is highest in G0 and G1 phases and decreases during S and G2/M phases.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression is induced by activation of the Ras-Raf signaling pathway, and this may require JUN and JUNB. Expression can be repressed by E2F1, E2F2, E2F3 and E2F4. Expression is also repressed by non-classical inhibitors of NF-kappa-B signaling such as doxorubicin, daunorubicin and UVC, and by the NF-kappa-B p65 subunit (RELA).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000042508 Expressed in 288 organ(s), highest expression level in rostral migratory stream

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8CE22 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8CE22 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the D-type cyclins CCND1, CCND2 and CCND3. Interaction with D-type cyclins may modulate transcriptional activation by this protein.

2 Publications

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q8CE22, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000071815

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8CE22

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini225 – 263Myb-like 1PROSITE-ProRule annotationAdd BLAST39
Domaini268 – 333HTH myb-typePROSITE-ProRule annotationAdd BLAST66
Domaini339 – 388Myb-like 2PROSITE-ProRule annotationAdd BLAST50

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 237Interaction with CCND2Add BLAST237
Regioni87 – 458Required for DNA-bindingAdd BLAST372
Regioni87 – 170Required for transcriptional activationAdd BLAST84
Regioni176 – 761Interaction with CCND1, CCND2 and CCND31 PublicationAdd BLAST586
Regioni459 – 761Required for transcriptional activationAdd BLAST303

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DMTF1 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0051 Eukaryota
COG5147 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156016

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8CE22

KEGG Orthology (KO)

More...
KOi
K21625

Identification of Orthologs from Complete Genome Data

More...
OMAi
EISPMGN

Database of Orthologous Groups

More...
OrthoDBi
1474117at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8CE22

TreeFam database of animal gene trees

More...
TreeFami
TF333537

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00167 SANT, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009057 Homeobox-like_sf
IPR017877 Myb-like_dom
IPR017930 Myb_dom
IPR001005 SANT/Myb

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00249 Myb_DNA-binding, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00717 SANT, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51294 HTH_MYB, 1 hit
PS50090 MYB_LIKE, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8CE22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTVEEDSDT VTVETVNSVT FTQDTDGNLI LHCPQNDPDE VDSEDSTEPP
60 70 80 90 100
HKRLCLSSED DQSIDDATPC ISVVALPLSE NDQSFEVTMT ATTEVADDEL
110 120 130 140 150
SEGTVTQIQI LQNDQLDEIS PLGTEEVSAV SQAWFTTKED KDSLTNKGHK
160 170 180 190 200
WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA
210 220 230 240 250
WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG
260 270 280 290 300
AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV
310 320 330 340 350
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR
360 370 380 390 400
IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP
410 420 430 440 450
VLIKGLKQLH ENQKNNPVLL ENKSGSGVPN SNCNSSVQHV QIRVARLEDN
460 470 480 490 500
TAISPSPMAA LQIPVQITHV SSTDSPAASV DSETITLNSG TLQTFEILPS
510 520 530 540 550
FHLQPTGTPG TYLLQTSSSQ GLPLTLTTNP TVTLAAAAPA SPEQIIVHAL
560 570 580 590 600
SPEHLLNTSD NVTVQCHTPR VIIQTVATED ITSSLSQEEL TVDSDLHSSD
610 620 630 640 650
FPEPPDALEA DTFPDEIPRP KMTIQPSFNN AHVSKFSDQN STELMNSVMV
660 670 680 690 700
RTEEEIADTD LKQEEPPSDL ASAYVTEDLE SPTIVHQVHQ TIDDETILIV
710 720 730 740 750
PSPHGFIQAS DVIDTESVLP LTTLTDPIFQ HHQEASNIIG SSLGSPVSED
760
SKDVEDLVNC H
Length:761
Mass (Da):84,644
Last modified:March 18, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB93810B0991CBE3
GO
Isoform 2 (identifier: Q8CE22-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-471: VLIKGLKQLHENQKNNPVLLENKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPMAALQIPVQITHVS → A

Show »
Length:691
Mass (Da):77,069
Checksum:i8798975155B11AD0
GO
Isoform 3 (identifier: Q8CE22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-471: VLIKGLKQLHENQKNNPVLLENKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPMAALQIPVQITHVS → A
     500-524: SFHLQPTGTPGTYLLQTSSSQGLPL → KRKLLLLHLVMGTRGHALMVMEVKG
     525-761: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:454
Mass (Da):51,513
Checksum:i1CF4652EE6E38750
GO
Isoform 4 (identifier: Q8CE22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     37-78: DPDEVDSEDSTEPPHKRLCLSSEDDQSIDDATPCISVVALPL → V
     402-451: LIKGLKQLHE...IRVARLEDNT → YSMFRSESPA...LLLLTQKQSH
     452-761: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:410
Mass (Da):47,310
Checksum:i5736F20A28015B9D
GO
Isoform 5 (identifier: Q8CE22-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-273: LRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT → QLWTPHNKGHTFKLWLSKVLLPTTCQPVRREKKNEE
     274-761: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:273
Mass (Da):31,373
Checksum:i512AFEFAC9C0D5A5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GXV6V9GXV6_MOUSE
Cyclin-D-binding Myb-like transcrip...
Dmtf1
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GXX1V9GXX1_MOUSE
Cyclin-D-binding Myb-like transcrip...
Dmtf1
673Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GWW5V9GWW5_MOUSE
Cyclin-D-binding Myb-like transcrip...
Dmtf1
289Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GXK4V9GXK4_MOUSE
Cyclin-D-binding Myb-like transcrip...
Dmtf1
232Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GWT2V9GWT2_MOUSE
Cyclin-D-binding Myb-like transcrip...
Dmtf1
248Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GX14V9GX14_MOUSE
Cyclin-D-binding Myb-like transcrip...
Dmtf1
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GX59V9GX59_MOUSE
Cyclin-D-binding Myb-like transcrip...
Dmtf1
17Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti44E → Q in BAC30386 (PubMed:16141072).Curated1
Sequence conflicti73V → F in BAC30386 (PubMed:16141072).Curated1
Sequence conflicti80E → Q in BAC30386 (PubMed:16141072).Curated1
Sequence conflicti180A → G in BAC26325 (PubMed:16141072).Curated1
Sequence conflicti480V → A in AAC52878 (PubMed:8887674).Curated1
Sequence conflicti502H → P in AAC52878 (PubMed:8887674).Curated1
Sequence conflicti532V → L in AAC52878 (PubMed:8887674).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03209437 – 78DPDEV…VALPL → V in isoform 4. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_032095238 – 273LRIKH…DTCNT → QLWTPHNKGHTFKLWLSKVL LPTTCQPVRREKKNEE in isoform 5. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032096274 – 761Missing in isoform 5. 1 PublicationAdd BLAST488
Alternative sequenceiVSP_032097401 – 471VLIKG…ITHVS → A in isoform 2 and isoform 3. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_032098402 – 451LIKGL…LEDNT → YSMFRSESPAWKIIQPSLQA PWQRCRFQSRSPTSLQQTPL LLLLTQKQSH in isoform 4. 2 PublicationsAdd BLAST50
Alternative sequenceiVSP_032099452 – 761Missing in isoform 4. 2 PublicationsAdd BLAST310
Alternative sequenceiVSP_032100500 – 524SFHLQ…QGLPL → KRKLLLLHLVMGTRGHALMV MEVKG in isoform 3. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_032101525 – 761Missing in isoform 3. 1 PublicationAdd BLAST237

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U70017 mRNA Translation: AAC52878.1
AK029147 mRNA Translation: BAC26325.1
AK031887 mRNA Translation: BAC27593.1
AK039563 mRNA Translation: BAC30386.1
AK046201 mRNA Translation: BAC32635.1
AK160595 mRNA Translation: BAE35902.1
BC045141 mRNA Translation: AAH45141.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19088.1 [Q8CE22-1]
CCDS51412.1 [Q8CE22-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001103797.1, NM_001110327.1 [Q8CE22-2]
NP_035936.3, NM_011806.3 [Q8CE22-1]
XP_011238970.1, XM_011240668.2 [Q8CE22-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000071921; ENSMUSP00000071815; ENSMUSG00000042508 [Q8CE22-1]
ENSMUST00000095017; ENSMUSP00000092627; ENSMUSG00000042508 [Q8CE22-2]
ENSMUST00000183448; ENSMUSP00000139042; ENSMUSG00000042508 [Q8CE22-5]
ENSMUST00000184159; ENSMUSP00000139231; ENSMUSG00000042508 [Q8CE22-4]
ENSMUST00000184401; ENSMUSP00000139281; ENSMUSG00000042508 [Q8CE22-5]
ENSMUST00000184888; ENSMUSP00000139164; ENSMUSG00000042508 [Q8CE22-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23857

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:23857

UCSC genome browser

More...
UCSCi
uc008wky.2 mouse [Q8CE22-1]
uc008wkz.2 mouse [Q8CE22-2]
uc008wld.2 mouse [Q8CE22-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70017 mRNA Translation: AAC52878.1
AK029147 mRNA Translation: BAC26325.1
AK031887 mRNA Translation: BAC27593.1
AK039563 mRNA Translation: BAC30386.1
AK046201 mRNA Translation: BAC32635.1
AK160595 mRNA Translation: BAE35902.1
BC045141 mRNA Translation: AAH45141.1
CCDSiCCDS19088.1 [Q8CE22-1]
CCDS51412.1 [Q8CE22-2]
RefSeqiNP_001103797.1, NM_001110327.1 [Q8CE22-2]
NP_035936.3, NM_011806.3 [Q8CE22-1]
XP_011238970.1, XM_011240668.2 [Q8CE22-1]

3D structure databases

SMRiQ8CE22
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ8CE22, 1 interactor
STRINGi10090.ENSMUSP00000071815

PTM databases

iPTMnetiQ8CE22
PhosphoSitePlusiQ8CE22

Proteomic databases

PaxDbiQ8CE22
PRIDEiQ8CE22

Genome annotation databases

EnsembliENSMUST00000071921; ENSMUSP00000071815; ENSMUSG00000042508 [Q8CE22-1]
ENSMUST00000095017; ENSMUSP00000092627; ENSMUSG00000042508 [Q8CE22-2]
ENSMUST00000183448; ENSMUSP00000139042; ENSMUSG00000042508 [Q8CE22-5]
ENSMUST00000184159; ENSMUSP00000139231; ENSMUSG00000042508 [Q8CE22-4]
ENSMUST00000184401; ENSMUSP00000139281; ENSMUSG00000042508 [Q8CE22-5]
ENSMUST00000184888; ENSMUSP00000139164; ENSMUSG00000042508 [Q8CE22-5]
GeneIDi23857
KEGGimmu:23857
UCSCiuc008wky.2 mouse [Q8CE22-1]
uc008wkz.2 mouse [Q8CE22-2]
uc008wld.2 mouse [Q8CE22-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9988
MGIiMGI:1344415 Dmtf1

Phylogenomic databases

eggNOGiKOG0051 Eukaryota
COG5147 LUCA
GeneTreeiENSGT00940000156016
InParanoidiQ8CE22
KOiK21625
OMAiEISPMGN
OrthoDBi1474117at2759
PhylomeDBiQ8CE22
TreeFamiTF333537

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dmtf1 mouse

Protein Ontology

More...
PROi
PR:Q8CE22

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000042508 Expressed in 288 organ(s), highest expression level in rostral migratory stream
ExpressionAtlasiQ8CE22 baseline and differential
GenevisibleiQ8CE22 MM

Family and domain databases

CDDicd00167 SANT, 3 hits
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017877 Myb-like_dom
IPR017930 Myb_dom
IPR001005 SANT/Myb
PfamiView protein in Pfam
PF00249 Myb_DNA-binding, 2 hits
SMARTiView protein in SMART
SM00717 SANT, 3 hits
SUPFAMiSSF46689 SSF46689, 3 hits
PROSITEiView protein in PROSITE
PS51294 HTH_MYB, 1 hit
PS50090 MYB_LIKE, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDMTF1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CE22
Secondary accession number(s): P70413
, Q3TUR9, Q80VR8, Q8BQX6, Q8CA56, Q8CCZ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: October 16, 2019
This is version 155 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again