Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostatic acid phosphatase

Gene

Acpp

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma (By similarity).By similarity
Isoform 2: the cellular form also has ecto-5'-nucleotidase activity in dorsal root ganglion (DRG) neurons. Generates adenosine from AMP which acts as a pain suppressor.1 Publication

Catalytic activityi

A phosphate monoester + H2O = an alcohol + phosphate.1 Publication
A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei42SubstrateBy similarity1
Active sitei43NucleophileBy similarity1
Binding sitei46SubstrateBy similarity1
Sitei48Important for substrate specificityBy similarity1
Binding sitei110SubstrateBy similarity1
Sitei137Required for dimerizationBy similarity1
Sitei143Required for dimerizationBy similarity1
Sitei205Required for structural stabilityBy similarity1
Binding sitei288SubstrateBy similarity1
Active sitei289Proton donorBy similarity1

GO - Molecular functioni

GO - Biological processi

  • adenosine metabolic process Source: UniProtKB
  • dephosphorylation Source: UniProtKB
  • nucleotide metabolic process Source: UniProtKB
  • positive regulation of adenosine receptor signaling pathway Source: UniProtKB
  • protein homotetramerization Source: MGI
  • purine nucleobase metabolic process Source: UniProtKB
  • regulation of sensory perception of pain Source: UniProtKB
  • thiamine metabolic process Source: UniProtKB

Keywordsi

Molecular functionHydrolase

Enzyme and pathway databases

ReactomeiR-MMU-6798695 Neutrophil degranulation

Names & Taxonomyi

Protein namesi
Recommended name:
Prostatic acid phosphatase (EC:3.1.3.2)
Alternative name(s):
5'-nucleotidase (EC:3.1.3.5)
Short name:
5'-NT
Ecto-5'-nucleotidase
Fluoride-resistant acid phosphatase
Short name:
FRAP
Thiamine monophosphatase
Short name:
TMPase
Gene namesi
Name:Acpp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1928480 Acpp

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Lysosome, Membrane, Secreted

Pathology & Biotechi

Disruption phenotypei

Null mice display greater thermal hyperalgesia (pain sensitivity) and mechanical allodynia. No thiamine monophosphatase (TMPase) activity detected in dorsal root ganglion (DRG) neurons.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 31Sequence analysisAdd BLAST31
ChainiPRO_000035629332 – 381Prostatic acid phosphataseAdd BLAST350

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi93N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi160 ↔ 371By similarity
Disulfide bondi214 ↔ 312By similarity
Glycosylationi219N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi332N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi346 ↔ 350By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8CE08
PeptideAtlasiQ8CE08
PRIDEiQ8CE08

PTM databases

PhosphoSitePlusiQ8CE08

Expressioni

Tissue specificityi

Isoform 1 is expressed in salivary gland, thymus and thyroid gland. Isoform 2 is widely expressed in prostate lobes, brain, kidney, liver, lung, muscle, placenta, salivary gland, spleen, thyroid and thymus. Locates to Schwann cells and fibroblasts. Expressed in peptidergic and non-peptidergic nociceptive (pain-sensing) neurons. Preferentially expressed in non-peptidergic doral root ganglia neurons.3 Publications

Gene expression databases

BgeeiENSMUSG00000032561
ExpressionAtlasiQ8CE08 baseline and differential
GenevisibleiQ8CE08 MM

Interactioni

Subunit structurei

Homodimer; dimer formation is required for phosphatase activity.By similarity

GO - Molecular functioni

Protein-protein interaction databases

ComplexPortaliCPX-121 Prostatic acid phosphatase complex
STRINGi10090.ENSMUSP00000059889

Structurei

3D structure databases

ProteinModelPortaliQ8CE08
SMRiQ8CE08
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the histidine acid phosphatase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3720 Eukaryota
ENOG410ZVBQ LUCA
GeneTreeiENSGT00530000062956
HOGENOMiHOG000231439
HOVERGENiHBG002203
InParanoidiQ8CE08
KOiK19283
OMAiYGIHKQK
OrthoDBiEOG091G09FA
TreeFamiTF312893

Family and domain databases

CDDicd07061 HP_HAP_like, 1 hit
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR033379 Acid_Pase_AS
IPR000560 His_Pase_clade-2
IPR029033 His_PPase_superfam
PfamiView protein in Pfam
PF00328 His_Phos_2, 1 hit
SUPFAMiSSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS00616 HIS_ACID_PHOSPHAT_1, 1 hit
PS00778 HIS_ACID_PHOSPHAT_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CE08-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRAVPLPLSR TASLSLGFLL LLSLCLDPGQ AKELKFVTLV FRHGDRGPIE
60 70 80 90 100
TFPTDPITES SWPQGFGQLT QWGMEQHYEL GSYIRKRYGR FLNDTYKHDQ
110 120 130 140 150
IYIRSTDVDR TLMSAMTNLA ALFPPEGISI WNPRLLWQPI PVHTVSLSED
160 170 180 190 200
RLLYLPFRDC PRFEELKSET LESEEFLKRL HPYKSFLDTL SSLSGFDDQD
210 220 230 240 250
LFGIWSKVYD PLFCESVHNF TLPSWATEDA MIKLKELSEL SLLSLYGIHK
260 270 280 290 300
QKEKSRLQGG VLVNEILKNM KLATQPQKYK KLVMYSAHDT TVSGLQMALD
310 320 330 340 350
VYNGVLPPYA SCHMMELYHD KGGHFVEMYY RNETQNEPYP LTLPGCTHSC
360 370 380
PLEKFAELLD PVISQDWATE CMATSSHQGR N
Length:381
Mass (Da):43,717
Last modified:March 1, 2003 - v1
Checksum:iC0077819D77CB251
GO
Isoform 2 (identifier: Q8CE08-2) [UniParc]FASTAAdd to basket
Also known as: TMPase, TM-PAP, cellular PAP, cPAP

The sequence of this isoform differs from the canonical sequence as follows:
     378-381: QGRN → QVLRVILATTFCLVTGILVILLLVLIRHGPCWQRDVYRNI

Show »
Length:417
Mass (Da):47,863
Checksum:i505B9B551BA5CEF7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2R → G in AAI39827 (PubMed:15489334).Curated1
Sequence conflicti3A → S in BAC36318 (PubMed:16141072).Curated1
Sequence conflicti10R → P in AAI39827 (PubMed:15489334).Curated1
Sequence conflicti145V → L in BAC36318 (PubMed:16141072).Curated1
Sequence conflicti230A → P in BAC36318 (PubMed:16141072).Curated1
Sequence conflicti264N → H in BAC36318 (PubMed:16141072).Curated1
Sequence conflicti355F → L in BAC36318 (PubMed:16141072).Curated1
Sequence conflicti357 – 358EL → DV in AAF23171 (Ref. 1) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_036024378 – 381QGRN → QVLRVILATTFCLVTGILVI LLLVLIRHGPCWQRDVYRNI in isoform 2. 2 Publications4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF210243 mRNA Translation: AAF23171.1
AK029273 mRNA Translation: BAC26366.1
AK076383 mRNA Translation: BAC36318.1
CT030733 Genomic DNA No translation available.
BC139826 mRNA Translation: AAI39827.1
CCDSiCCDS23460.1 [Q8CE08-2]
CCDS40750.1 [Q8CE08-1]
RefSeqiNP_062781.2, NM_019807.2 [Q8CE08-1]
NP_997551.1, NM_207668.2 [Q8CE08-2]
UniGeneiMm.19941

Genome annotation databases

EnsembliENSMUST00000062723; ENSMUSP00000059889; ENSMUSG00000032561 [Q8CE08-2]
ENSMUST00000112590; ENSMUSP00000108209; ENSMUSG00000032561 [Q8CE08-1]
GeneIDi56318
KEGGimmu:56318
UCSCiuc009rhl.1 mouse [Q8CE08-2]
uc009rhm.1 mouse [Q8CE08-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPPAP_MOUSE
AccessioniPrimary (citable) accession number: Q8CE08
Secondary accession number(s): A4QPG2
, B8JJZ5, B8JJZ6, Q8C682, Q9QXH7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 16, 2008
Last sequence update: March 1, 2003
Last modified: June 20, 2018
This is version 104 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health