Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8CDK2 (CBPC2_MOUSE)

Entry version 133 (02 Dec 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Cytosolic carboxypeptidase 2

Gene

Agbl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Does not show detyrosinase or deglycylase activities from the carboxy-terminus of tubulin.1 Publication

Caution

Was originally thought to have detyrosinating activity from C-terminal positions on tubulin.By similarity

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by RARRES1.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi425ZincBy similarity1
Metal bindingi428ZincBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei475NucleophileBy similarity1
Metal bindingi521ZincBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCarboxypeptidase, Hydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Protein family/group databases

MEROPS protease database

More...MEROPSi		M14.029

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytosolic carboxypeptidase 2 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Agbl2
Synonyms:Ccp2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2443254, Agbl2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

AGBL2 and AGBL3 double mutants are viable and display no obvious phenotypic alterations.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi593E → A: Abolishes deglutamylase activity. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002837501 – 862Cytosolic carboxypeptidase 2Add BLAST862

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8CDK2

PRoteomics IDEntifications database

More...PRIDEi		Q8CDK2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8CDK2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8CDK2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in tissues with motile cilia such as testis, lung and trachea. Also detected in brain, eye, muscle, pancreas, intestine, stomach, pituitary, spleen, adrenal and kidney. Expressed in mitral and granular cells in brain.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during ciliogenesis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000040812, Expressed in spermatocyte and 49 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8CDK2, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		Q8CDK2, 1 interactor

Molecular INTeraction database

More...MINTi		Q8CDK2

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000129216

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8CDK2, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3641, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160201

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8CDK2

Database of Orthologous Groups

More...OrthoDBi		481670at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8CDK2

TreeFam database of animal gene trees

More...TreeFami		TF313794

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR040626, Pepdidase_M14_N
IPR000834, Peptidase_M14

Pfam protein domain database

More...Pfami		View protein in Pfam
PF18027, Pepdidase_M14_N, 1 hit
PF00246, Peptidase_M14, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8CDK2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNVLLEMAFL SQTLPDPYED FIHHHLQYYG YFKAQKSSLP NSGTHQRVWR 
        60         70         80         90        100
NSPRYMLNGS FGERDDFISD SLEKEMLLWP TCLSSTGHAH IDAVNRDSLL 
       110        120        130        140        150
LSSPLLRTRQ LIFDELDEAS PRLREPRELF SCFSSRGPLQ APRWPIECEV 
       160        170        180        190        200
IKENIHHIEW VPHQPEYFYQ PTGSEKVPEI VGEEQGTVVY QLDSVPAEGT 
       210        220        230        240        250
YFTSSRIGGK RGTIKELAVT LQGPDDNTLL FESRFESGNL QKAVRVGIYE 
       260        270        280        290        300
YELTLRTDLY TDKHTQWFYF RVQNTRKDAT YRFTIVNLLK PKSLYAVGMK 
       310        320        330        340        350
PLMYSQLDAT IYNIGWRREG REIKYYKNNV DDGQQPLYCL TWTTQFPHDQ 
       360        370        380        390        400
DTCFFAHFYP YTYTDLQCYL LSVANNPIQS QFCKLRALCR SLAGNTVYLL 
       410        420        430        440        450
TITNPSRTPQ EAAAKKAVVL SARVHPGESN SSWIMNGFLD FILSNSPDAQ 
       460        470        480        490        500
LLRDIFVFKV IPMLNPDGVI VGNYRCSLAG RDLNRHYKTV LKDSFPCIWY 
       510        520        530        540        550
TKNMIKRLLE EREVLLYCDF HGHSRKNNIF LYGCHSNNRK HWLHERVFPL 
       560        570        580        590        600
MLSKNAPDKF SFDSCNFKVQ KCKEGTGRVV MWRMGIINSY TMESTFGGST 
       610        620        630        640        650
LGSKRDTHFT IEDLKSLGYH VCDTLLDFCD PDQTKYTQCL QELKELLQQE 
       660        670        680        690        700
INKKLNNFGQ DMDLEGNWSD IPLSDIESST SGSDSSLSDG PPIRLLNIVA 
       710        720        730        740        750
DEPNQKTVLK NPKKKRLQTR KQRNEQYQKS YLMRELKLTE NAPGRARFVS 
       760        770        780        790        800
TLQKQPTFLK SPESPSPSVR RSENPRLNET QLSGREKGTS LDPPLTSPKN 
       810        820        830        840        850
KERIQSKKPG FTASCSPKRS TNSSLGPAPD VKPNWSKTRY SATRKDHATM 
       860 
AVYPSLHIYT YP
Length:862
Mass (Da):99,216
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB532FEB80F6A8D04
GO
Isoform 2 (identifier: Q8CDK2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     806-809: SKKP → GFST
     810-862: Missing.

Show »
Length:809
Mass (Da):93,340
Checksum:iBAE5C35E86AE2D94
GO
Isoform 3 (identifier: Q8CDK2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     807-836: KKPGFTASCSPKRSTNSSLGPAPDVKPNWS → YSQPCVFSLILHEHQAQTSSDTPCQNPESH
     837-862: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:836
Mass (Da):96,401
Checksum:iDE456D5716FB146E
GO
Isoform 4 (identifier: Q8CDK2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     744-779: Missing.

Show »
Length:826
Mass (Da):95,136
Checksum:i0022036D11432658
GO
Isoform 5 (identifier: Q8CDK2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-97: WPTCLSSTGHAHIDAVNRD → Y
     744-779: Missing.

Show »
Length:808
Mass (Da):93,237
Checksum:iF036094EF78C2951
GO
Isoform 6 (identifier: Q8CDK2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-12: NVLLEMAFLSQ → FPALETELKPE
     806-809: SKKP → GFST
     810-862: Missing.

Show »
Length:809
Mass (Da):93,349
Checksum:iAAAEE32F6C6C44B4
GO
Isoform 7 (identifier: Q8CDK2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-298: Missing.
     807-836: KKPGFTASCSPKRSTNSSLGPAPDVKPNWS → YSQPCVFSLILHEHQAQTSSDTPCQNPESH
     837-862: Missing.

Show »
Length:538
Mass (Da):61,885
Checksum:iB2B37B861A63FCF7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4J1L6A0A0B4J1L6_MOUSE
Cytosolic carboxypeptidase 2
Agbl2
711Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ABI51945 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence ABI51946 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence ABI51947 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence ABI51948 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence ABI51949 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC37726 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAM20823 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti134S → F in BAC26827 (PubMed:16141072).Curated1
Sequence conflicti146I → L in BAC26827 (PubMed:16141072).Curated1
Sequence conflicti206R → T in BAC26827 (PubMed:16141072).Curated1
Sequence conflicti749V → F in BAC26827 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0243621 – 298Missing in isoform 7. 1 PublicationAdd BLAST298
Alternative sequenceiVSP_0243632 – 12NVLLEMAFLSQ → FPALETELKPE in isoform 6. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_02436479 – 97WPTCL…AVNRD → Y in isoform 5. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_024365744 – 779Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_024366806 – 809SKKP → GFST in isoform 2 and isoform 6. 2 Publications4
Alternative sequenceiVSP_024367807 – 836KKPGF…KPNWS → YSQPCVFSLILHEHQAQTSS DTPCQNPESH in isoform 3 and isoform 7. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_024368810 – 862Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST53
Alternative sequenceiVSP_024369837 – 862Missing in isoform 3 and isoform 7. 2 PublicationsAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
DQ867026 mRNA Translation: ABI51945.1 Different initiation.
DQ867027 mRNA Translation: ABI51946.1 Different initiation.
DQ867028 mRNA Translation: ABI51947.1 Different initiation.
DQ867029 mRNA Translation: ABI51948.1 Different initiation.
DQ867030 mRNA Translation: ABI51949.1 Different initiation.
AK029744 mRNA Translation: BAC26594.1
AK029932 mRNA Translation: BAC26686.1
AK030138 mRNA Translation: BAC26802.1
AK030182 mRNA Translation: BAC26827.1
AK040259 mRNA Translation: BAC30555.2
AK079691 mRNA Translation: BAC37726.2 Different initiation.
AL714026 Genomic DNA Translation: CAM20823.1 Sequence problems.
AL714026 Genomic DNA Translation: CAM20824.1
AL714026 Genomic DNA Translation: CAM20825.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS38177.2 [Q8CDK2-1]
CCDS89512.1 [Q8CDK2-6]

NCBI Reference Sequences

More...RefSeqi		NP_848870.2, NM_178755.3 [Q8CDK2-1]
XP_006499695.1, XM_006499632.2 [Q8CDK2-1]
XP_006499703.1, XM_006499640.1 [Q8CDK2-4]
XP_006499704.1, XM_006499641.3
XP_006499705.1, XM_006499642.3 [Q8CDK2-2]
XP_006499706.1, XM_006499643.1 [Q8CDK2-5]
XP_011237881.1, XM_011239579.1 [Q8CDK2-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000037206; ENSMUSP00000047936; ENSMUSG00000040812 [Q8CDK2-6]
ENSMUST00000037219; ENSMUSP00000048647; ENSMUSG00000040812 [Q8CDK2-1]
ENSMUST00000051831; ENSMUSP00000051620; ENSMUSG00000040812 [Q8CDK2-3]
ENSMUST00000111481; ENSMUSP00000107106; ENSMUSG00000040812 [Q8CDK2-1]
ENSMUST00000170320; ENSMUSP00000129216; ENSMUSG00000040812 [Q8CDK2-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		271813

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:271813

UCSC genome browser

More...UCSCi		uc008ktc.2, mouse [Q8CDK2-6]
uc008ktd.2, mouse [Q8CDK2-2]
uc008kte.2, mouse [Q8CDK2-1]
uc008ktg.2, mouse [Q8CDK2-4]
uc008kth.2, mouse [Q8CDK2-5]
uc008ktk.1, mouse [Q8CDK2-7]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ867026 mRNA Translation: ABI51945.1 Different initiation.
DQ867027 mRNA Translation: ABI51946.1 Different initiation.
DQ867028 mRNA Translation: ABI51947.1 Different initiation.
DQ867029 mRNA Translation: ABI51948.1 Different initiation.
DQ867030 mRNA Translation: ABI51949.1 Different initiation.
AK029744 mRNA Translation: BAC26594.1
AK029932 mRNA Translation: BAC26686.1
AK030138 mRNA Translation: BAC26802.1
AK030182 mRNA Translation: BAC26827.1
AK040259 mRNA Translation: BAC30555.2
AK079691 mRNA Translation: BAC37726.2 Different initiation.
AL714026 Genomic DNA Translation: CAM20823.1 Sequence problems.
AL714026 Genomic DNA Translation: CAM20824.1
AL714026 Genomic DNA Translation: CAM20825.1
CCDSiCCDS38177.2 [Q8CDK2-1]
CCDS89512.1 [Q8CDK2-6]
RefSeqiNP_848870.2, NM_178755.3 [Q8CDK2-1]
XP_006499695.1, XM_006499632.2 [Q8CDK2-1]
XP_006499703.1, XM_006499640.1 [Q8CDK2-4]
XP_006499704.1, XM_006499641.3
XP_006499705.1, XM_006499642.3 [Q8CDK2-2]
XP_006499706.1, XM_006499643.1 [Q8CDK2-5]
XP_011237881.1, XM_011239579.1 [Q8CDK2-5]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

IntActiQ8CDK2, 1 interactor
MINTiQ8CDK2
STRINGi10090.ENSMUSP00000129216

Protein family/group databases

MEROPSiM14.029

PTM databases

iPTMnetiQ8CDK2
PhosphoSitePlusiQ8CDK2

Proteomic databases

PaxDbiQ8CDK2
PRIDEiQ8CDK2

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1166, 107 antibodies

The DNASU plasmid repository

More...DNASUi		271813

Genome annotation databases

EnsembliENSMUST00000037206; ENSMUSP00000047936; ENSMUSG00000040812 [Q8CDK2-6]
ENSMUST00000037219; ENSMUSP00000048647; ENSMUSG00000040812 [Q8CDK2-1]
ENSMUST00000051831; ENSMUSP00000051620; ENSMUSG00000040812 [Q8CDK2-3]
ENSMUST00000111481; ENSMUSP00000107106; ENSMUSG00000040812 [Q8CDK2-1]
ENSMUST00000170320; ENSMUSP00000129216; ENSMUSG00000040812 [Q8CDK2-1]
GeneIDi271813
KEGGimmu:271813
UCSCiuc008ktc.2, mouse [Q8CDK2-6]
uc008ktd.2, mouse [Q8CDK2-2]
uc008kte.2, mouse [Q8CDK2-1]
uc008ktg.2, mouse [Q8CDK2-4]
uc008kth.2, mouse [Q8CDK2-5]
uc008ktk.1, mouse [Q8CDK2-7]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		79841
MGIiMGI:2443254, Agbl2

Phylogenomic databases

eggNOGiKOG3641, Eukaryota
GeneTreeiENSGT00940000160201
InParanoidiQ8CDK2
OrthoDBi481670at2759
PhylomeDBiQ8CDK2
TreeFamiTF313794

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		271813, 0 hits in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Agbl2, mouse

Protein Ontology

More...PROi		PR:Q8CDK2
RNActiQ8CDK2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000040812, Expressed in spermatocyte and 49 other tissues
ExpressionAtlasiQ8CDK2, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR040626, Pepdidase_M14_N
IPR000834, Peptidase_M14
PfamiView protein in Pfam
PF18027, Pepdidase_M14_N, 1 hit
PF00246, Peptidase_M14, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCBPC2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CDK2
Secondary accession number(s): A2AH35
, Q09M08, Q09M09, Q09M10, Q09M11, Q09M12, Q8C529, Q8C9X4, Q8CDE6, Q8CDF6, Q8CDQ1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: March 1, 2003
Last modified: December 2, 2020
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again