Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8CBQ5 (P4K2B_MOUSE)

Entry version 122 (12 Aug 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Phosphatidylinositol 4-kinase type 2-beta

Gene

Pi4k2b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Recruited and activated by membrane association. Binding to the microsomal membrane has been shown to enhance its activity (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei136ATPBy similarity1
Binding sitei332ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi115 – 121ATPBy similarity7
Nucleotide bindingi245 – 248ATPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-1483248, Synthesis of PIPs at the ER membrane
R-MMU-1660499, Synthesis of PIPs at the plasma membrane
R-MMU-1660514, Synthesis of PIPs at the Golgi membrane
R-MMU-1660516, Synthesis of PIPs at the early endosome membrane

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatidylinositol 4-kinase type 2-beta (EC:2.7.1.67)
Alternative name(s):
Phosphatidylinositol 4-kinase type II-beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pi4k2b
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1914323, Pi4k2b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002851651 – 469Phosphatidylinositol 4-kinase type 2-betaAdd BLAST469

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei37PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8CBQ5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8CBQ5

PeptideAtlas

More...PeptideAtlasi		Q8CBQ5

PRoteomics IDEntifications database

More...PRIDEi		Q8CBQ5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8CBQ5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8CBQ5

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8CBQ5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000029186, Expressed in left lung lobe and 277 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8CBQ5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000031081

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8CBQ5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8CBQ5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini117 – 424PI3K/PI4KAdd BLAST308

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni141 – 143Important for substrate bindingBy similarity3
Regioni149 – 162Important for interaction with membranesBy similarityAdd BLAST14
Regioni252 – 260Important for interaction with membranesBy similarity9
Regioni345 – 354Important for interaction with membranesBy similarity10

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2381, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000010434

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_032516_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8CBQ5

KEGG Orthology (KO)

More...KOi		K13711

Identification of Orthologs from Complete Genome Data

More...OMAi		ECGVFPE

Database of Orthologous Groups

More...OrthoDBi		1273723at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8CBQ5

TreeFam database of animal gene trees

More...TreeFami		TF314740

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039756, Lsb6/PI4K2
IPR000403, PI3/4_kinase_cat_dom

The PANTHER Classification System

More...PANTHERi		PTHR12865, PTHR12865, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00454, PI3_PI4_kinase, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8CBQ5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEACEPTRP SEDEDEEREP LLPRVAWAQP RRVAPGSAVR MQADEGADVL 
        60         70         80         90        100
REPATDEPPA VSGEGSISAS LSTELDRTRT TSSETNTFLE DPEFADIVLK 
       110        120        130        140        150
AEQAIEIGVF PERISQGSSG SYFVKDSKRN IIGVFKPKSE EPYGQLNPKW 
       160        170        180        190        200
TKYVHKVCCP CCFGRGCLLP NQGYLSEAGA YLVDVKLNLG IVPKTKVVWL 
       210        220        230        240        250
VSETFNYSAI DRAKSRGKKY ALEKVPKVGR KFHRIGLPPK VGSFQLFVKD 
       260        270        280        290        300
YKEAEYWLRR FEAEPLPENI RKQFQSQFEK LVILDYIIRN TDRGNDNWLV 
       310        320        330        340        350
KYDEMKYAKK IESEESNWID NKQLLIKIAA IDNGLAFPFK HPDEWRAYPF 
       360        370        380        390        400
HWAWLPQAKV PFSEETRNLI LPYISDMNFV QDLCEDLYEL FKTDKGFDRA 
       410        420        430        440        450
AFENQMSVMR GQILNLTQAL RDGKSPMQLA QMPCVIVECS KSGSQGRVVH 
       460 
LGSSFTQTVH CRKPFFSSW
Length:469
Mass (Da):53,478
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB5CE80948E5B8954
GO
Isoform 2 (identifier: Q8CBQ5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-129: ETNTFLEDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKR → GPELCPFYSRSLCYKTTTALGYY

Show »
Length:446
Mass (Da):50,962
Checksum:iD32EB3277F0B160F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JEK1A0A0G2JEK1_MOUSE
Phosphatidylinositol 4-kinase type ...
Pi4k2b
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti199W → L in AAL04155 (Ref. 1) Curated1
Sequence conflicti199W → L in BAB27819 (PubMed:16141072).Curated1
Sequence conflicti229 – 236GRKFHRIG → AESPSDR in AAN37399 (Ref. 2) Curated8
Sequence conflicti244F → S in AAN37399 (Ref. 2) Curated1
Sequence conflicti244F → S in BAB30411 (PubMed:16141072).Curated1
Sequence conflicti261F → Y in AAN37399 (Ref. 2) Curated1
Sequence conflicti261F → Y in BAB30411 (PubMed:16141072).Curated1
Sequence conflicti399R → K in AAH10257 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02482884 – 129ETNTF…KDSKR → GPELCPFYSRSLCYKTTTAL GYY in isoform 2. 2 PublicationsAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF411321 mRNA Translation: AAL04155.1
AY148879 mRNA Translation: AAN37399.1
AK011751 mRNA Translation: BAB27819.1
AK016754 mRNA Translation: BAB30411.1
AK035523 mRNA Translation: BAC29091.1
AK170730 mRNA Translation: BAE41986.1
BC010257 mRNA Translation: AAH10257.1
BC062144 mRNA Translation: AAH62144.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS19287.1 [Q8CBQ5-1]
CCDS39086.1 [Q8CBQ5-2]

NCBI Reference Sequences

More...RefSeqi		NP_080227.2, NM_025951.3 [Q8CBQ5-1]
NP_083020.2, NM_028744.3 [Q8CBQ5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000031081; ENSMUSP00000031081; ENSMUSG00000029186 [Q8CBQ5-1]
ENSMUST00000031082; ENSMUSP00000031082; ENSMUSG00000029186 [Q8CBQ5-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		67073

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:67073

UCSC genome browser

More...UCSCi		uc008xkq.2, mouse [Q8CBQ5-1]
uc008xkr.2, mouse [Q8CBQ5-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF411321 mRNA Translation: AAL04155.1
AY148879 mRNA Translation: AAN37399.1
AK011751 mRNA Translation: BAB27819.1
AK016754 mRNA Translation: BAB30411.1
AK035523 mRNA Translation: BAC29091.1
AK170730 mRNA Translation: BAE41986.1
BC010257 mRNA Translation: AAH10257.1
BC062144 mRNA Translation: AAH62144.1
CCDSiCCDS19287.1 [Q8CBQ5-1]
CCDS39086.1 [Q8CBQ5-2]
RefSeqiNP_080227.2, NM_025951.3 [Q8CBQ5-1]
NP_083020.2, NM_028744.3 [Q8CBQ5-2]

3D structure databases

SMRiQ8CBQ5
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000031081

PTM databases

iPTMnetiQ8CBQ5
PhosphoSitePlusiQ8CBQ5
SwissPalmiQ8CBQ5

Proteomic databases

EPDiQ8CBQ5
PaxDbiQ8CBQ5
PeptideAtlasiQ8CBQ5
PRIDEiQ8CBQ5

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1318, 159 antibodies

Genome annotation databases

EnsembliENSMUST00000031081; ENSMUSP00000031081; ENSMUSG00000029186 [Q8CBQ5-1]
ENSMUST00000031082; ENSMUSP00000031082; ENSMUSG00000029186 [Q8CBQ5-2]
GeneIDi67073
KEGGimmu:67073
UCSCiuc008xkq.2, mouse [Q8CBQ5-1]
uc008xkr.2, mouse [Q8CBQ5-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55300
MGIiMGI:1914323, Pi4k2b

Phylogenomic databases

eggNOGiKOG2381, Eukaryota
GeneTreeiENSGT00390000010434
HOGENOMiCLU_032516_1_0_1
InParanoidiQ8CBQ5
KOiK13711
OMAiECGVFPE
OrthoDBi1273723at2759
PhylomeDBiQ8CBQ5
TreeFamiTF314740

Enzyme and pathway databases

ReactomeiR-MMU-1483248, Synthesis of PIPs at the ER membrane
R-MMU-1660499, Synthesis of PIPs at the plasma membrane
R-MMU-1660514, Synthesis of PIPs at the Golgi membrane
R-MMU-1660516, Synthesis of PIPs at the early endosome membrane

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		67073, 0 hits in 19 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Pi4k2b, mouse

Protein Ontology

More...PROi		PR:Q8CBQ5
RNActiQ8CBQ5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000029186, Expressed in left lung lobe and 277 other tissues
GenevisibleiQ8CBQ5, MM

Family and domain databases

InterProiView protein in InterPro
IPR039756, Lsb6/PI4K2
IPR000403, PI3/4_kinase_cat_dom
PANTHERiPTHR12865, PTHR12865, 1 hit
PfamiView protein in Pfam
PF00454, PI3_PI4_kinase, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiP4K2B_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8CBQ5
Secondary accession number(s): Q91Z30, Q9D072, Q9D471
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: March 1, 2003
Last modified: August 12, 2020
This is version 122 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again