Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MICOS complex subunit Mic60

Gene

Immt

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology.By similarity

GO - Biological processi

  • cristae formation Source: MGI
  • mitochondrial calcium ion homeostasis Source: MGI

Names & Taxonomyi

Protein namesi
Recommended name:
MICOS complex subunit Mic60
Alternative name(s):
Mitochondrial inner membrane protein
Mitofilin
Gene namesi
Name:Immt
Synonyms:Mic60
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1923864 Immt

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini34 – 45Mitochondrial matrixSequence analysisAdd BLAST12
Transmembranei46 – 65HelicalSequence analysisAdd BLAST20
Topological domaini66 – 757Mitochondrial intermembraneSequence analysisAdd BLAST692

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 33MitochondrionSequence analysisAdd BLAST33
ChainiPRO_000008418534 – 757MICOS complex subunit Mic60Add BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei112PhosphoserineBy similarity1
Modified residuei113PhosphoserineBy similarity1
Modified residuei210N6-acetyllysineBy similarity1
Modified residuei221N6-acetyllysineBy similarity1
Modified residuei222PhosphoserineBy similarity1
Modified residuei387PhosphoserineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei450N6-acetyllysineBy similarity1
Modified residuei506PhosphotyrosineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ8CAQ8
PaxDbiQ8CAQ8
PeptideAtlasiQ8CAQ8
PRIDEiQ8CAQ8

2D gel databases

REPRODUCTION-2DPAGEiQ8CAQ8

PTM databases

iPTMnetiQ8CAQ8
PhosphoSitePlusiQ8CAQ8
SwissPalmiQ8CAQ8

Expressioni

Gene expression databases

BgeeiENSMUSG00000052337
CleanExiMM_IMMT
ExpressionAtlasiQ8CAQ8 baseline and differential
GenevisibleiQ8CAQ8 MM

Interactioni

Subunit structurei

Component of the mitochondrial contact site and cristae organizing system (MICOS) complex, composed of at least MINOS1/MIC10, CHCHD3/MIC19, CHCHD6/MIC25, APOOL/MIC27, IMMT/MIC60, APOO/MIC23/MIC26 and QIL1/MIC13. This complex was also known under the names MINOS or MitOS complex. The MICOS complex associates with mitochondrial outer membrane proteins SAMM50, MTX1 and MTX2 (together described as components of the mitochondrial outer membrane sorting assembly machinery (SAM) complex) and DNAJC11, mitochondrial inner membrane protein TMEM11 and with HSPA9. The MICOS and SAM complexes together with DNAJC11 are part of a large protein complex spanning both membranes termed the mitochondrial intermembrane space bridging (MIB) complex. Interacts with QIL1/MIC13, MINOS1/MIC10, CHCHD3/MIC19, CHCHD6/MIC25, SAMM50 and TMEM11. Interacts with APOO/MIC23/MIC26 and APOOL/MIC27 (By similarity). Interacts with HSPA1A/HSPA1B and OPA1, preferentially with the soluble OPA1 form.By similarity1 Publication

Protein-protein interaction databases

BioGridi218208, 29 interactors
CORUMiQ8CAQ8
DIPiDIP-32050N
IntActiQ8CAQ8, 38 interactors
MINTiQ8CAQ8
STRINGi10090.ENSMUSP00000066181

Structurei

3D structure databases

ProteinModelPortaliQ8CAQ8
SMRiQ8CAQ8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili199 – 231Sequence analysisAdd BLAST33
Coiled coili279 – 317Sequence analysisAdd BLAST39
Coiled coili397 – 442Sequence analysisAdd BLAST46

Sequence similaritiesi

Belongs to the MICOS complex subunit Mic60 family.Curated

Keywords - Domaini

Coiled coil, Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1854 Eukaryota
ENOG410Y49V LUCA
GeneTreeiENSGT00390000002313
HOVERGENiHBG039233
InParanoidiQ8CAQ8
KOiK17785
OMAiGWKGMSI
OrthoDBiEOG091G04QE
PhylomeDBiQ8CAQ8
TreeFamiTF312832

Family and domain databases

InterProiView protein in InterPro
IPR019133 Mt-IM_prot_Mitofilin
PANTHERiPTHR15415 PTHR15415, 1 hit
PfamiView protein in Pfam
PF09731 Mitofilin, 1 hit

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8CAQ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLRACQLSGV TVAAQSCLCG KFVLRPLRPC RRYSTSSSSG LTAGKIAGAG
60 70 80 90 100
LLFVGGGIGG TILYAKWDSH FRESVEKTIP YSDKLFGMVL GSAPYTVPLP
110 120 130 140 150
KKPVQSGPLK ISSVSEVMKD SKLPVAQSQK TKGDTPASAA STGAAQIISA
160 170 180 190 200
AGDTLSVPAP AVQHEDTIKT ECPNTNEGKS TSETTEEAFS SSVRERPPEE
210 220 230 240 250
VAARLAQQEK QEQVEMESLA KSLEDALNRT SSVTLQTITA QNAAVQAVKA
260 270 280 290 300
HSNILKTAMD NSEIAGEKKS AQWRTVEGAL KERRKAVDEA ADALLKAKEE
310 320 330 340 350
LEKMKTIIED AKKREIAGAT PHITAAEGRL HNMIVDLDNV VKKVQAAQSE
360 370 380 390 400
AKVVSQYHEL VVQARDDFRK ELDSITPDIT PGWKGMSISD LAGKLSTDDL
410 420 430 440 450
NSLIAHAHRR IDQLNRELAQ QKATEKQHIE LALEKHKLEE KRTFDSAVAK
460 470 480 490 500
ALEHHRSEIQ AEQDRKVEEV RDAMENEMRT QLRRQAAAHT DHLRDVLKVQ
510 520 530 540 550
EQELKYEFEQ GLSEKLSEQE LEFRRRSQEQ MDSFTLDINT AYARLRGIEQ
560 570 580 590 600
AVQSHAVAEE EARKAHQLWL SVEALKYSMK TSSAEMPTIP LGSAVEAIRV
610 620 630 640 650
NCSDNEFTQA LTAAIPPESL TRGVYSEETL RARFYAVQKL ARRVAMIDET
660 670 680 690 700
RNSLYQYFLS YLQSLLLFPP KQLKPPAELY PEDINTFKLL SYASYCIEHG
710 720 730 740 750
DLELAAKFVN QLKGESRRVA QDWLKEARMT LETKQIVEIL TAYASAVGIG

TTQVQQE
Length:757
Mass (Da):83,900
Last modified:March 1, 2003 - v1
Checksum:i5EB37BCA054BD7A6
GO
Isoform 2 (identifier: Q8CAQ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-151: Missing.

Show »
Length:746
Mass (Da):82,929
Checksum:iD7163AC815B9D0D0
GO
Isoform 3 (identifier: Q8CAQ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-151: Missing.
     186-218: EEAFSSSVRERPPEEVAARLAQQEKQEQVEMES → A
     387-392: SISDLA → T

Note: No experimental confirmation available.
Show »
Length:709
Mass (Da):78,727
Checksum:iE5E8EC4154F1853D
GO
Isoform 4 (identifier: Q8CAQ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-151: Missing.
     186-194: EEAFSSSVR → GSLIIYIML
     195-757: Missing.

Note: May be due to intron retention. No experimental confirmation available.
Show »
Length:183
Mass (Da):19,194
Checksum:i67A485D7DF8DA8D4
GO
Isoform 5 (identifier: Q8CAQ8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     757-757: E → FWIKAVFKSQMSNPTSFKVTRLNSVQKNRSSPLI

Note: No experimental confirmation available.
Show »
Length:790
Mass (Da):87,694
Checksum:i85B4294F1E2C734E
GO

Sequence cautioni

The sequence BAB24817 differs from that shown. Reason: Frameshift at position 754.Curated
The sequence BAB24817 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti532D → E in BAB24817 (PubMed:16141072).Curated1
Sequence conflicti658F → L in BAB24817 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007003141 – 151Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_007004186 – 218EEAFS…VEMES → A in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_013222186 – 194EEAFSSSVR → GSLIIYIML in isoform 4. 1 Publication9
Alternative sequenceiVSP_013223195 – 757Missing in isoform 4. 1 PublicationAdd BLAST563
Alternative sequenceiVSP_007005387 – 392SISDLA → T in isoform 3. 1 Publication6
Alternative sequenceiVSP_013224757E → FWIKAVFKSQMSNPTSFKVT RLNSVQKNRSSPLI in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006977 mRNA Translation: BAB24817.1 Sequence problems.
AK030841 mRNA Translation: BAC27154.1
AK033126 mRNA Translation: BAC28163.1
AK038129 mRNA Translation: BAC29936.1
AK049189 mRNA Translation: BAC33599.1
BC055840 mRNA Translation: AAH55840.1
BC080790 mRNA Translation: AAH80790.1
CCDSiCCDS39509.1 [Q8CAQ8-1]
CCDS57425.1 [Q8CAQ8-2]
CCDS57426.1 [Q8CAQ8-3]
RefSeqiNP_001240610.1, NM_001253681.1 [Q8CAQ8-2]
NP_001240616.1, NM_001253687.1 [Q8CAQ8-3]
NP_001240617.1, NM_001253688.1
NP_083949.2, NM_029673.3 [Q8CAQ8-1]
UniGeneiMm.235123
Mm.490578

Genome annotation databases

EnsembliENSMUST00000064062; ENSMUSP00000066181; ENSMUSG00000052337 [Q8CAQ8-1]
ENSMUST00000101301; ENSMUSP00000098859; ENSMUSG00000052337 [Q8CAQ8-2]
ENSMUST00000114151; ENSMUSP00000109788; ENSMUSG00000052337 [Q8CAQ8-3]
GeneIDi76614
KEGGimmu:76614
UCSCiuc009che.2 mouse [Q8CAQ8-4]
uc009chi.2 mouse [Q8CAQ8-1]
uc009chj.2 mouse [Q8CAQ8-2]
uc009chm.2 mouse [Q8CAQ8-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMIC60_MOUSE
AccessioniPrimary (citable) accession number: Q8CAQ8
Secondary accession number(s): Q66JS4
, Q7TNE2, Q8C7V1, Q8CCI0, Q8CDA8, Q9D9F6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: March 1, 2003
Last modified: March 28, 2018
This is version 125 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health