Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (12 Aug 2020)
Sequence version 3 (10 Oct 2018)
Previous versions | rss
Add a publicationFeedback
Protein

Sperm flagellar protein 2

Gene

Spef2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for correct axoneme development in spermatozoa (PubMed:21715716, PubMed:28619825). Important for normal development of the manchette and sperm head morphology (PubMed:28619825). Essential for male fertility (PubMed:21715716, PubMed:28619825). Plays a role in localization of the intraflagellar transport protein IFT20 to the manchette, suggesting function as an adapter for dynein-mediated protein transport during spermatogenesis. Also plays a role in bone growth where it seems to be required for normal osteoblast differentiation (PubMed:28619825).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDifferentiation, Spermatogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sperm flagellar protein 2
Alternative name(s):
Protein KPL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Spef2
Synonyms:Kpl2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443727, Spef2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Lethality occurs at approximately 3 weeks of age, accompanied by severe hydrocephaly. Weight at birth is similar to wild type but subsequently there is significant growth retardation. Bone mineralization is reduced in the vertebral column and hindlimbs, associated with decreased bone strength. Bone length and skull thickness is also slightly reduced. Trabecular bone density is reduced, along with reduced trabecular number and increased open porosity. Expression of the osteoblast marker genes RUNX2, BGLAP/OCN and COL1A1/COL1 is reduced in bone tissue. Expression of SP7/OSX and ALPL is also reduced in cultured calvarial osteoblasts. Osteoclast differentiation does not appear to be affected. No obvious effects on cilia length or axonemal structure.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002990301 – 1724Sperm flagellar protein 2Add BLAST1724

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q8C9J3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8C9J3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8C9J3

PRoteomics IDEntifications database

More...
PRIDEi
Q8C9J3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8C9J3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8C9J3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis, where it primarily localizes to late spermatocytes, round spermatids and elongating spermatids (at protein level) (PubMed:19889948, PubMed:29339787). Found in Sertoli cells of the testis (at protein level) (PubMed:19889948). Expressed at lower levels in epididymis (at protein level) (PubMed:19889948, PubMed:29339787). Detected in lung, brain, liver and kidney (PubMed:19889948, PubMed:29339787). Also detected in bone, cartilage, trachea, pituitary gland and eye (PubMed:29339787). Expressed in osteoblasts and chondrocytes (PubMed:29339787).2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Shows increasing expression levels in testis during postnatal stages, reaching highest levels by postnatal day 50. In testis, first detected in pachytene spermatocytes (stage VII), reaching peak expression in meitotically dividing spermatocytes (stage XII).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000072663, Expressed in olfactory epithelium and 67 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8C9J3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8C9J3, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminus) with IFT20 (PubMed:19889948).

Interacts with DYNC1I2 (PubMed:28619825).

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
235900, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q8C9J3, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000035762

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8C9J3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 105Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST105

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1228 – 1580Interaction with IFT20By similarityAdd BLAST353

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili170 – 203Sequence analysisAdd BLAST34
Coiled coili255 – 351Sequence analysisAdd BLAST97
Coiled coili665 – 691Sequence analysisAdd BLAST27
Coiled coili995 – 1021Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1191 – 1220Lys-richAdd BLAST30

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QR7Y, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008160

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_048290_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8C9J3

Identification of Orthologs from Complete Genome Data

More...
OMAi
ALPWPIP

Database of Orthologous Groups

More...
OrthoDBi
81320at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8C9J3

TreeFam database of animal gene trees

More...
TreeFami
TF329522

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001715, CH-domain
IPR010441, CH_2
IPR036872, CH_dom_sf
IPR011992, EF-hand-dom_pair
IPR027417, P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06294, CH_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50021, CH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: A number of isoforms are produced.1 Publication

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C9J3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEILCQWLN QELRVSRTVS PKSFAKAFSN GYLIGEVLFK FELQSDFAEF
60 70 80 90 100
SESRGSTAKL NNFSRLQPTL HLLGLQFDQN VAQSIITEKP GAATKLLYQL
110 120 130 140 150
YIALQKKKKT GLTGLEIQTM QPQTNLRLQT LKSEAFREQR LNRRRQNEIM
160 170 180 190 200
AKIQAAIIQI PKPESNRTLK AIEAQKLMKK KKEAEDVANE IKKFEALIKK
210 220 230 240 250
DLQIKESVSK TSLETTDQTT AELLNTYSDD DYIKKIQKRL EEDAFAREQR
260 270 280 290 300
EKRRRRLLMD QLMAHEAQEE AYREEQLIHR LMRQSQQERR IAVQLMHVRH
310 320 330 340 350
EKEVLWQNRI FREKQFEERR LKDFQDALDR EAALAKQAKI DFAEQTLREK
360 370 380 390 400
EIHEKISVER AQQRYKKHYG ICAEILDQML DLCTKVADYR LLTNNLIPHK
410 420 430 440 450
MMHDWKELFF SGIPIYEQTS LTHGQTEPTE DHRAEVKKRN LLDSKDYEDY
460 470 480 490 500
KNMVGEWALP EDMVNSSPPS NNSILGHVLL RLIEKADPSA SNAEATELPS
510 520 530 540 550
LAVKGCILGK TLSGKTTVLK SLQNDFPVHV LSIDTLVQEA IQAFHERQKS
560 570 580 590 600
GKTPPTQEDD KRDPVVNQEK VSKTQDKNVL AVSPVPGDRT SQKEGVKINE
610 620 630 640 650
FEQFRSSDSF LSLSMRAQLG AKSELMLRRG KSIPDILLVS ILVNAIKEIP
660 670 680 690 700
VDQSWVLDGF PITLNQAKLL EEALTGYKRK FLQLKKKKEQ MPTLALDPST
710 720 730 740 750
STEVSLLPSA LDFVILLDIS DNSSLARTND IIAKEISHEI SHENVGRPGT
760 770 780 790 800
GTSQDNKSED RNLRDHIQHR IVGFLDNWPL LEEWFTQPKN ILTKVNAEID
810 820 830 840 850
EALLCQKVKE IFATETVNKK IKVEKTLEEK ETEKKAGAPP AEPPAMSPPL
860 870 880 890 900
SSEAEKDKEL HQAKTPGKGK TQSVSPKGKA QGGKVSVKKS PVGSAEVSPT
910 920 930 940 950
PTAPPPPKAG TEEWVYVNEP IPEELPSFLV PYWELIEKSY INHIKTVLRH
960 970 980 990 1000
LRERQHNVLS YLYETRTSFQ EFLRRPDHKQ DFVSQWQADF NSVPEDLWED
1010 1020 1030 1040 1050
EETKAELHQR VNDLRDRLWD ICEARKEEAE QERLDIINES WLQDSIGITM
1060 1070 1080 1090 1100
NHFFSLMQAE VNRFQDTKRL LQDYYRAMES KIPLEDSKKF TRVPLVQLDG
1110 1120 1130 1140 1150
KEISESQLRI PLVPRISNSP ENSAVKPKVG TFLKGRSDPP LEVLEANFEI
1160 1170 1180 1190 1200
DEKILLDTWQ QASLAISNMV AAEVHQRLTE EEKEPPQLDS KEKSPQSGAN
1210 1220 1230 1240 1250
KKAKKEKEAP KKKKTDKKGK GKSSPVAEVS PVTVTPEEMA EMEKRNELRL
1260 1270 1280 1290 1300
RIKEEHLAAL QTEEQAAQFR LELIKLKALS VLEDLVTKVI DVYRLMEKWL
1310 1320 1330 1340 1350
GKRYLNEMAS IQKLTELARY HIETATKIQN EIYLSQEDFY INGDIKVFPD
1360 1370 1380 1390 1400
PSPPTRPPPV EREENGTLTI EQLDNLRDQF LDMAPKGIIG NKAFSDILLD
1410 1420 1430 1440 1450
LITLNLGTNN FPSSWMHLSQ LDLQEITSLL TVNTEFVDWR KFLMVTAMPW
1460 1470 1480 1490 1500
PMALEDELLD TLQRFKALDE AQTGTITYEQ YKQAGLWFSG DEDIKIPENP
1510 1520 1530 1540 1550
LEPLPFNRQE HLIEFFFRLF ADCEKEPPQL DYTQMLLYFA CHPDTLEGVY
1560 1570 1580 1590 1600
RALSVAVGTH IFRQVETPML MAEKTSISTV SPIEEFPETE ESSAKEDREL
1610 1620 1630 1640 1650
KEEKDDQKEE EIPENANTEK ISMETLLKVF GGGNEVLDAN RFASYLKSEN
1660 1670 1680 1690 1700
IYAENFIKTF QDLGARNLEP IAVNILLKHP YIQDLIANYV DYKFPDIKMI
1710 1720
LQRSEHAQGS DGERSPSRLT DEKK
Length:1,724
Mass (Da):197,972
Last modified:October 10, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9AB4F1737BD770C1
GO
Isoform 2 (identifier: Q8C9J3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     873-875: SVS → SGD
     876-1724: Missing.

Show »
Length:875
Mass (Da):100,091
Checksum:i7D70836A6FDA674A
GO
Isoform 3 (identifier: Q8C9J3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     452-456: NMVGE → VHTNM
     457-1724: Missing.

Show »
Length:456
Mass (Da):53,886
Checksum:i614A16FA4EEA74CC
GO
Isoform 4 (identifier: Q8C9J3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     138-138: E → ERLKNLIPRQTDFNLMRVTCRFQEKCKQMKEDLARMNFEKFEKIQKLEEEQRHFNIEK
     873-873: S → SETQHGKQESQPEGKGKK

Show »
Length:1,798
Mass (Da):207,021
Checksum:i7A07496096FA2A72
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E0CX63E0CX63_MOUSE
Sperm flagellar protein 2
Spef2
622Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140LIV1A0A140LIV1_MOUSE
Sperm flagellar protein 2
Spef2
2,076Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E0CY95E0CY95_MOUSE
Sperm flagellar protein 2
Spef2
513Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1146A → T in AEA11026 (PubMed:21715716).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_059848138E → ERLKNLIPRQTDFNLMRVTC RFQEKCKQMKEDLARMNFEK FEKIQKLEEEQRHFNIEK in isoform 4. 1
Alternative sequenceiVSP_027526452 – 456NMVGE → VHTNM in isoform 3. 1 Publication5
Alternative sequenceiVSP_027527457 – 1724Missing in isoform 3. 1 PublicationAdd BLAST1268
Alternative sequenceiVSP_027528873 – 875SVS → SGD in isoform 2. 1 Publication3
Alternative sequenceiVSP_059849873S → SETQHGKQESQPEGKGKK in isoform 4. 1
Alternative sequenceiVSP_027529876 – 1724Missing in isoform 2. 1 PublicationAdd BLAST849

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
HQ856050 mRNA Translation: AEA11026.1
AK041992 mRNA Translation: BAC31126.1
AC133586 Genomic DNA No translation available.
AC133959 Genomic DNA No translation available.
BC132098 mRNA Translation: AAI32099.1
BC132288 mRNA Translation: AAI32289.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37041.1 [Q8C9J3-2]
CCDS84163.1 [Q8C9J3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001291971.1, NM_001305042.1 [Q8C9J3-4]
NP_001291973.1, NM_001305044.1 [Q8C9J3-3]
NP_796097.2, NM_177123.4 [Q8C9J3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000041840; ENSMUSP00000035762; ENSMUSG00000072663 [Q8C9J3-2]
ENSMUST00000159368; ENSMUSP00000124723; ENSMUSG00000072663 [Q8C9J3-3]
ENSMUST00000160236; ENSMUSP00000124222; ENSMUSG00000072663 [Q8C9J3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
320277

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:320277

UCSC genome browser

More...
UCSCi
uc007vfq.2, mouse [Q8C9J3-2]
uc007vfr.2, mouse [Q8C9J3-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
HQ856050 mRNA Translation: AEA11026.1
AK041992 mRNA Translation: BAC31126.1
AC133586 Genomic DNA No translation available.
AC133959 Genomic DNA No translation available.
BC132098 mRNA Translation: AAI32099.1
BC132288 mRNA Translation: AAI32289.1
CCDSiCCDS37041.1 [Q8C9J3-2]
CCDS84163.1 [Q8C9J3-3]
RefSeqiNP_001291971.1, NM_001305042.1 [Q8C9J3-4]
NP_001291973.1, NM_001305044.1 [Q8C9J3-3]
NP_796097.2, NM_177123.4 [Q8C9J3-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi235900, 4 interactors
IntActiQ8C9J3, 1 interactor
STRINGi10090.ENSMUSP00000035762

PTM databases

iPTMnetiQ8C9J3
PhosphoSitePlusiQ8C9J3

Proteomic databases

jPOSTiQ8C9J3
MaxQBiQ8C9J3
PaxDbiQ8C9J3
PRIDEiQ8C9J3

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22874, 43 antibodies

Genome annotation databases

EnsembliENSMUST00000041840; ENSMUSP00000035762; ENSMUSG00000072663 [Q8C9J3-2]
ENSMUST00000159368; ENSMUSP00000124723; ENSMUSG00000072663 [Q8C9J3-3]
ENSMUST00000160236; ENSMUSP00000124222; ENSMUSG00000072663 [Q8C9J3-1]
GeneIDi320277
KEGGimmu:320277
UCSCiuc007vfq.2, mouse [Q8C9J3-2]
uc007vfr.2, mouse [Q8C9J3-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79925
MGIiMGI:2443727, Spef2

Phylogenomic databases

eggNOGiENOG502QR7Y, Eukaryota
GeneTreeiENSGT00390000008160
HOGENOMiCLU_048290_0_0_1
InParanoidiQ8C9J3
OMAiALPWPIP
OrthoDBi81320at2759
PhylomeDBiQ8C9J3
TreeFamiTF329522

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
320277, 1 hit in 13 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Spef2, mouse

Protein Ontology

More...
PROi
PR:Q8C9J3
RNActiQ8C9J3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000072663, Expressed in olfactory epithelium and 67 other tissues
ExpressionAtlasiQ8C9J3, baseline and differential
GenevisibleiQ8C9J3, MM

Family and domain databases

Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR001715, CH-domain
IPR010441, CH_2
IPR036872, CH_dom_sf
IPR011992, EF-hand-dom_pair
IPR027417, P-loop_NTPase
PfamiView protein in Pfam
PF06294, CH_2, 1 hit
SUPFAMiSSF47473, SSF47473, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50021, CH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPEF2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8C9J3
Secondary accession number(s): A2RSG5, E0CYG3, G0Z098
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: October 10, 2018
Last modified: August 12, 2020
This is version 121 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again