Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q8C854 (MYEF2_MOUSE)

Entry version 141 (02 Dec 2020)
Sequence version 1 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Myelin expression factor 2

Gene

Myef2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor, RNA-binding
Biological processTranscription

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myelin expression factor 2
Short name:
MEF-2
Short name:
MyEF-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Myef2
Synonyms:Kiaa1341, Mef2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componentsi: Chromosome 2, Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:104592, Myef2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000816561 – 591Myelin expression factor 2Add BLAST591

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki44Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei397Omega-N-methylarginineCombined sources1
Modified residuei417Omega-N-methylarginineCombined sources1
Modified residuei422PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q8C854

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q8C854

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q8C854

PeptideAtlas

More...PeptideAtlasi		Q8C854

PRoteomics IDEntifications database

More...PRIDEi		Q8C854

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q8C854

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q8C854

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q8C854

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000027201, Expressed in ventricular zone and 281 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q8C854, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q8C854, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		201640, 17 interactors

Protein interaction database and analysis system

More...IntActi		Q8C854, 8 interactors

Molecular INTeraction database

More...MINTi		Q8C854

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000123088

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q8C854, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q8C854

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini91 – 169RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini224 – 301RRM 2PROSITE-ProRule annotationAdd BLAST78
Domaini514 – 590RRM 3PROSITE-ProRule annotationAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi321 – 513Gly-richAdd BLAST193

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0118, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157397

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_019566_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q8C854

Identification of Orthologs from Complete Genome Data

More...OMAi		GTRSKGC

Database of Orthologous Groups

More...OrthoDBi		1174365at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q8C854

TreeFam database of animal gene trees

More...TreeFami		TF313406

Family and domain databases

Conserved Domains Database

More...CDDi		cd12658, RRM1_MYEF2, 1 hit
cd12662, RRM3_MYEF2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.70.330, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR034632, MYEF2
IPR034630, MYEF2_RRM1
IPR034631, MYEF2_RRM3
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR000504, RRM_dom

The PANTHER Classification System

More...PANTHERi		PTHR23003:SF15, PTHR23003:SF15, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00076, RRM_1, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00360, RRM, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54928, SSF54928, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50102, RRM, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C854-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADADKSEAA AGDDGSQQQP AEPRRDTHPG EPEKPPRSSA NGVKMENDES 
        60         70         80         90        100
VKEEKSDLKE KSTGNKKANR FHPYSKDKNS GTGEKKGPNR NRVFISNIPY 
       110        120        130        140        150
DMKWQAIKDL MREKVGEVTY VELFKDAEGK SRGCGVVEFK DEEFVKKALE 
       160        170        180        190        200
TMNKYDLSGR PLNIKEDPDG ENARRALQRT GTSFQGSHAS DVGSGLVNLP 
       210        220        230        240        250
PSILNNPNIP PEVISNLQAG RLGSTIFVAN LDFKVGWKKL KEVFSIAGTV 
       260        270        280        290        300
KRADIKEDKD GKSRGMGTVT FEQAIEAVQA ISMFNGQFLF DRPMHVKMDD 
       310        320        330        340        350
KSVPHEDYRS HDSKTSQLPR GLGGIGMGLG PGGQPISASQ LNITGVMGNL 
       360        370        380        390        400
GPSGMGMDGP GFGGVNRIGG GVGFGGLEAM NSMAGFGGVG RMGELYRGAM 
       410        420        430        440        450
TSSMERDFGR GDIGLSRGFG DSFGRLGSAM IGGFAGRIGA SNMGPVGTGI 
       460        470        480        490        500
SGSMSGMSTV TGGMGMGLDR MSSSFDRMGP GIGAILERSI DVDRGFLSGP 
       510        520        530        540        550
MGSGMRDRLG SKGNQIFVRN LPFDLTWQKL KEKFSQCGHV MFAEIKMENG 
       560        570        580        590 
KSKGCGTVRF ESAESAEKAC RIMNGIKISG REIDVRLDRN A
Length:591
Mass (Da):63,295
Last modified:March 1, 2003 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7F30703C519DB9A6
GO
Isoform 2 (identifier: Q8C854-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-370: Missing.

Show »
Length:574
Mass (Da):61,734
Checksum:iFC3A44B015C32E86
GO
Isoform 3 (identifier: Q8C854-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     427-451: GSAMIGGFAGRIGASNMGPVGTGIS → G
     511-512: SK → RN
     513-591: Missing.

Show »
Length:488
Mass (Da):52,213
Checksum:i797C87A2C49DF8CC
GO
Isoform 4 (identifier: Q8C854-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-451: ELYRGAMTSSMERDFGRGDIGLSRGFGDSFGRLGSAMIGGFAGRIGASNMGPVGTGIS → G
     539-555: HVMFAEIKMENGKSKGC → QINRDSKTHSNCGQHHS
     556-591: Missing.

Show »
Length:498
Mass (Da):53,544
Checksum:iEB086DAAA1D41429
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2ATP5A2ATP5_MOUSE
Myelin expression factor 2
Myef2
550Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XJA1F6XJA1_MOUSE
Myelin expression factor 2
Myef2
446Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2ATP6A2ATP6_MOUSE
Myelin expression factor 2
Myef2
567Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G8JL68G8JL68_MOUSE
Myelin expression factor 2
Myef2
530Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH60946 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC98146 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti341L → R in AAA78270 (PubMed:7534248).Curated1
Sequence conflicti537C → L in AAA78270 (PubMed:7534248).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013455354 – 370Missing in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_013456394 – 451ELYRG…GTGIS → G in isoform 4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_013457427 – 451GSAMI…GTGIS → G in isoform 3. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_013458511 – 512SK → RN in isoform 3. 1 Publication2
Alternative sequenceiVSP_013459513 – 591Missing in isoform 3. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_013460539 – 555HVMFA…KSKGC → QINRDSKTHSNCGQHHS in isoform 4. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_013461556 – 591Missing in isoform 4. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK048404 mRNA Translation: BAC33325.1
AK129336 mRNA Translation: BAC98146.1 Different initiation.
BC060946 mRNA Translation: AAH60946.1 Different initiation.
AF483504 mRNA Translation: AAL90778.1
AF483505 mRNA Translation: AAL90779.1
U13262 mRNA Translation: AAA78270.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS50690.1 [Q8C854-3]
CCDS50691.1 [Q8C854-4]

Protein sequence database of the Protein Information Resource

More...PIRi		A56704

NCBI Reference Sequences

More...RefSeqi		NP_001155889.1, NM_001162417.1 [Q8C854-4]
XP_006498947.1, XM_006498884.3 [Q8C854-3]
XP_017171620.1, XM_017316131.1 [Q8C854-4]
XP_017171621.1, XM_017316132.1 [Q8C854-4]
XP_017171623.1, XM_017316134.1 [Q8C854-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000061419; ENSMUSP00000058811; ENSMUSG00000049230 [Q8C854-2]
ENSMUST00000067780; ENSMUSP00000066312; ENSMUSG00000027201 [Q8C854-3]
ENSMUST00000110501; ENSMUSP00000106127; ENSMUSG00000027201 [Q8C854-3]
ENSMUST00000152367; ENSMUSP00000123088; ENSMUSG00000027201 [Q8C854-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		17876

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:17876

UCSC genome browser

More...UCSCi		uc008mbw.2, mouse [Q8C854-4]
uc008mby.2, mouse [Q8C854-3]
uc012cdb.1, mouse [Q8C854-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK048404 mRNA Translation: BAC33325.1
AK129336 mRNA Translation: BAC98146.1 Different initiation.
BC060946 mRNA Translation: AAH60946.1 Different initiation.
AF483504 mRNA Translation: AAL90778.1
AF483505 mRNA Translation: AAL90779.1
U13262 mRNA Translation: AAA78270.1
CCDSiCCDS50690.1 [Q8C854-3]
CCDS50691.1 [Q8C854-4]
PIRiA56704
RefSeqiNP_001155889.1, NM_001162417.1 [Q8C854-4]
XP_006498947.1, XM_006498884.3 [Q8C854-3]
XP_017171620.1, XM_017316131.1 [Q8C854-4]
XP_017171621.1, XM_017316132.1 [Q8C854-4]
XP_017171623.1, XM_017316134.1 [Q8C854-4]

3D structure databases

SMRiQ8C854
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi201640, 17 interactors
IntActiQ8C854, 8 interactors
MINTiQ8C854
STRINGi10090.ENSMUSP00000123088

PTM databases

iPTMnetiQ8C854
PhosphoSitePlusiQ8C854
SwissPalmiQ8C854

Proteomic databases

EPDiQ8C854
MaxQBiQ8C854
PaxDbiQ8C854
PeptideAtlasiQ8C854
PRIDEiQ8C854

Genome annotation databases

EnsembliENSMUST00000061419; ENSMUSP00000058811; ENSMUSG00000049230 [Q8C854-2]
ENSMUST00000067780; ENSMUSP00000066312; ENSMUSG00000027201 [Q8C854-3]
ENSMUST00000110501; ENSMUSP00000106127; ENSMUSG00000027201 [Q8C854-3]
ENSMUST00000152367; ENSMUSP00000123088; ENSMUSG00000027201 [Q8C854-4]
GeneIDi17876
KEGGimmu:17876
UCSCiuc008mbw.2, mouse [Q8C854-4]
uc008mby.2, mouse [Q8C854-3]
uc012cdb.1, mouse [Q8C854-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		50804
MGIiMGI:104592, Myef2

Rodent Unidentified Gene-Encoded large proteins database

More...Rougei		Search...

Phylogenomic databases

eggNOGiKOG0118, Eukaryota
GeneTreeiENSGT00940000157397
HOGENOMiCLU_019566_1_0_1
InParanoidiQ8C854
OMAiGTRSKGC
OrthoDBi1174365at2759
PhylomeDBiQ8C854
TreeFamiTF313406

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		17876, 1 hit in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Myef2, mouse

Protein Ontology

More...PROi		PR:Q8C854
RNActiQ8C854, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000027201, Expressed in ventricular zone and 281 other tissues
ExpressionAtlasiQ8C854, baseline and differential
GenevisibleiQ8C854, MM

Family and domain databases

CDDicd12658, RRM1_MYEF2, 1 hit
cd12662, RRM3_MYEF2, 1 hit
Gene3Di3.30.70.330, 3 hits
InterProiView protein in InterPro
IPR034632, MYEF2
IPR034630, MYEF2_RRM1
IPR034631, MYEF2_RRM3
IPR012677, Nucleotide-bd_a/b_plait_sf
IPR035979, RBD_domain_sf
IPR000504, RRM_dom
PANTHERiPTHR23003:SF15, PTHR23003:SF15, 1 hit
PfamiView protein in Pfam
PF00076, RRM_1, 3 hits
SMARTiView protein in SMART
SM00360, RRM, 3 hits
SUPFAMiSSF54928, SSF54928, 3 hits
PROSITEiView protein in PROSITE
PS50102, RRM, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYEF2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8C854
Secondary accession number(s): Q60690
, Q6P930, Q6ZPT3, Q8QZZ1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: March 1, 2003
Last modified: December 2, 2020
This is version 141 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again