Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase TRIM9

Gene

Trim9

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.By similarity
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri10 – 50RING-typePROSITE-ProRule annotationAdd BLAST41
Zinc fingeri163 – 212B box-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri224 – 266B box-type 2PROSITE-ProRule annotationAdd BLAST43

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM9 (EC:2.3.2.27By similarity)
Alternative name(s):
RING-type E3 ubiquitin transferase TRIM9Curated
Tripartite motif-containing protein 9
Gene namesi
Name:Trim9
Synonyms:Kiaa0282
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:2137354 Trim9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000562091 – 817E3 ubiquitin-protein ligase TRIM9Add BLAST817

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei41PhosphothreonineCombined sources1
Modified residuei44PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Modified residuei49PhosphoserineCombined sources1
Modified residuei53PhosphoserineCombined sources1

Post-translational modificationi

Auto-ubiquitinated.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ8C7M3
PeptideAtlasiQ8C7M3
PRIDEiQ8C7M3

PTM databases

iPTMnetiQ8C7M3
PhosphoSitePlusiQ8C7M3

Expressioni

Tissue specificityi

Brain. Expression is higher in the cerebral cortex and hippocampus (at protein level). Its expression is mainly confined to the central nervous system. The developing neocortex, the dorsal thalamus, the midbrain, the basal area of the hindbrain and spinal cord show high level of expression during embryogenesis. In adult brain, it is detected in the Purkinje cells of the cerebellum, in the hippocampus, and in the cortex.2 Publications

Developmental stagei

First seen at E9.5. From E9.5 to E11.5, it remains uniformly present in the ventral part of the entire neuroepithelium and in the dorsal root ganglia. A more restricted central nervous system (CNS) expression is observed at E13.5 and E15.5 when it is present in specific regions of the forebrain, midbrain, hindbrain and spinal cord.1 Publication

Gene expression databases

BgeeiENSMUSG00000021071 Expressed in 193 organ(s), highest expression level in piriform cortex
CleanExiMM_TRIM9
ExpressionAtlasiQ8C7M3 baseline and differential
GenevisibleiQ8C7M3 MM

Interactioni

Subunit structurei

Interacts with SNAP25.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi220445, 5 interactors
IntActiQ8C7M3, 1 interactor
MINTiQ8C7M3
STRINGi10090.ENSMUSP00000106151

Structurei

3D structure databases

ProteinModelPortaliQ8C7M3
SMRiQ8C7M3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini374 – 432COSPROSITE-ProRule annotationAdd BLAST59
Domaini440 – 535Fibronectin type-IIIPROSITE-ProRule annotationAdd BLAST96
Domaini613 – 794B30.2/SPRYPROSITE-ProRule annotationAdd BLAST182

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili273 – 340Sequence analysisAdd BLAST68

Domaini

The coiled coil domain mediates the interaction with the N-terminal t-SNARE domain of SNAP25.By similarity

Sequence similaritiesi

Belongs to the TRIM/RBCC family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri10 – 50RING-typePROSITE-ProRule annotationAdd BLAST41
Zinc fingeri163 – 212B box-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri224 – 266B box-type 2PROSITE-ProRule annotationAdd BLAST43

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG4367 Eukaryota
ENOG410XQMV LUCA
GeneTreeiENSGT00760000118878
HOVERGENiHBG062305
InParanoidiQ8C7M3
KOiK10649
OMAiHGTHEVK
PhylomeDBiQ8C7M3

Family and domain databases

CDDicd00063 FN3, 1 hit
Gene3Di2.60.40.10, 1 hit
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001870 B30.2/SPRY
IPR003649 Bbox_C
IPR013320 ConA-like_dom_sf
IPR017903 COS_domain
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR003877 SPRY_dom
IPR035029 TRIM9
IPR000315 Znf_B-box
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PANTHERiPTHR44104:SF3 PTHR44104:SF3, 1 hit
PfamiView protein in Pfam
PF00041 fn3, 1 hit
PF00622 SPRY, 1 hit
PF00643 zf-B_box, 1 hit
SMARTiView protein in SMART
SM00502 BBC, 1 hit
SM00336 BBOX, 2 hits
SM00060 FN3, 1 hit
SM00184 RING, 1 hit
SM00449 SPRY, 1 hit
SUPFAMiSSF49265 SSF49265, 1 hit
SSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50188 B302_SPRY, 1 hit
PS51262 COS, 1 hit
PS50853 FN3, 1 hit
PS50119 ZF_BBOX, 2 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C7M3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEMEEELKC PVCGSFYREP IILPCSHNLC QACARNILVQ TPESESPQSR
60 70 80 90 100
RASGSGVSDY DYLDLDKMSL YSEADSGYGS YGGFASAPTT PCQKSPNGVR
110 120 130 140 150
VFPPAMPPPP THLSPALAPV PRNSCITCPQ CHRSLILDDR GLRGFPKNRV
160 170 180 190 200
LEGVIDRYQQ SKAAALKCQL CEKAPKEATV MCEQCDVFYC DPCRLRCHPP
210 220 230 240 250
RGPLAKHRLV PPAQGRVSRR LSPRKVSTCT DHELENHSMY CVQCKMPVCY
260 270 280 290 300
QCLEEGKHSS HEVKALGAMW KLHKSQLSQA LNGLSDRAKE AKEFLVQLRT
310 320 330 340 350
MVQQIQENSV EFEACLVAQC DALIDALNRR KAQLLARVNK EHEHKLKVVR
360 370 380 390 400
DQISHCTVKL RQTTGLMEYC LEVIKENDPS GFLQISDALI RRVHLTEDQW
410 420 430 440 450
GKGTLTPRMT TDFDLSLDNS PLLQSIHQLD FVQVKASSPV PATPILQLEE
460 470 480 490 500
CCTHNNSATL SWKQPPLSTV AADGYILELD DGSGGQFREV YVGKETMCTV
510 520 530 540 550
DGLHFNSTYN ARVKAFNKTG VSPYSKTLVL QTSEAAGAHE TKPMKDTDSE
560 570 580 590 600
EQTLPFPVPS ERLPLRRMSP FSSTLNLQPS FPGRSYFDFR SSPHQLSLHS
610 620 630 640 650
SLQSLNAPGC NFETQSASYS QLVDIKKLLA VAWFAFDPGS AHSDIIFSND
660 670 680 690 700
NLTVTCSSYD DRVVLGKTGF SKGVHYWELT IDRYDNHPDP AFGVARIDVM
710 720 730 740 750
KDMMLGKDDK AWAMYVDNNR SWFMHNNSHT NRTEGGITKG ATIGVLLDLN
760 770 780 790 800
RKTLTFFVNN EQQGPIAFEN VEGLFFPAVS LNRNVQVSLW APGLRACSGC
810
YFKVCPGAVK SPQAPAP
Note: May be due to an intron retention.
Length:817
Mass (Da):90,870
Last modified:August 4, 2003 - v2
Checksum:iF23A355F6FF5762D
GO
Isoform 2 (identifier: Q8C7M3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I

Note: May be due to a competing acceptor splice site and to an exon skipping.
Show »
Length:798
Mass (Da):88,507
Checksum:iF078FC75904D43DC
GO
Isoform 3 (identifier: Q8C7M3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-608: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I
     788-817: SLWAPGLRACSGCYFKVCPGAVKSPQAPAP → TLHTGLPVPDFYSSRASIA

Note: May be due to a competing donor splice site and ?.
Show »
Length:714
Mass (Da):79,311
Checksum:i5395B4EDC3465ADD
GO
Isoform 4 (identifier: Q8C7M3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     546-565: DTDSEEQTLPFPVPSERLPL → GMCGWRQSILRLLGIVLLVD
     566-817: Missing.

Note: May be due to an intron retention.
Show »
Length:565
Mass (Da):62,861
Checksum:i0F105433DEBFC20A
GO
Isoform 5 (identifier: Q8C7M3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-630: Missing.

Note: May be due to exon skipping.
Show »
Length:721
Mass (Da):80,236
Checksum:i291E76ECE8DAAA5E
GO
Isoform 6 (identifier: Q8C7M3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-536: AA → GR
     537-817: Missing.

Note: May be due to an exon inclusion.
Show »
Length:536
Mass (Da):59,727
Checksum:i32EBC120E3D71B91
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QLH4E9QLH4_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
788Annotation score:
E9Q524E9Q524_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
547Annotation score:
A0A1Y7VP88A0A1Y7VP88_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
710Annotation score:
A0A1Y7VJX8A0A1Y7VJX8_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
772Annotation score:

Sequence cautioni

The sequence BAC97919 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27H → D in BAC28552 (PubMed:16141072).Curated1
Sequence conflicti251Q → H in BAC33982 (PubMed:16141072).Curated1
Sequence conflicti254E → Q in BAC33982 (PubMed:16141072).Curated1
Sequence conflicti319Q → R in AAG53493 (PubMed:11331580).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007932535 – 630Missing in isoform 5. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_007931535 – 608Missing in isoform 3. 2 PublicationsAdd BLAST74
Alternative sequenceiVSP_007933535 – 536AA → GR in isoform 6. 1 Publication2
Alternative sequenceiVSP_007930535Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_007934537 – 817Missing in isoform 6. 1 PublicationAdd BLAST281
Alternative sequenceiVSP_007937546 – 565DTDSE…ERLPL → GMCGWRQSILRLLGIVLLVD in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_007938566 – 817Missing in isoform 4. 1 PublicationAdd BLAST252
Alternative sequenceiVSP_007935714 – 732MYVDN…SHTNR → I in isoform 2 and isoform 3. 2 PublicationsAdd BLAST19
Alternative sequenceiVSP_007936788 – 817SLWAP…QAPAP → TLHTGLPVPDFYSSRASIA in isoform 3. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049907 mRNA Translation: BAC33982.1
AK034029 mRNA Translation: BAC28552.1
AK028280 mRNA Translation: BAC25854.1
AK048875 mRNA Translation: BAC33479.1
AK129109 mRNA Translation: BAC97919.1 Different initiation.
BC052034 mRNA Translation: AAH52034.1
AF220039 mRNA Translation: AAG53493.1
CCDSiCCDS49077.1 [Q8C7M3-3]
RefSeqiNP_001103672.1, NM_001110202.1 [Q8C7M3-3]
NP_001103673.1, NM_001110203.1
NP_001273315.1, NM_001286386.1 [Q8C7M3-6]
NP_001273316.1, NM_001286387.1
NP_001273317.1, NM_001286388.1
NP_444397.2, NM_053167.3
UniGeneiMm.184012

Genome annotation databases

EnsembliENSMUST00000110520; ENSMUSP00000106149; ENSMUSG00000021071 [Q8C7M3-3]
ENSMUST00000221041; ENSMUSP00000152496; ENSMUSG00000021071 [Q8C7M3-4]
ENSMUST00000221370; ENSMUSP00000152692; ENSMUSG00000021071 [Q8C7M3-6]
ENSMUST00000222316; ENSMUSP00000152147; ENSMUSG00000021071 [Q8C7M3-1]
GeneIDi94090
KEGGimmu:94090
UCSCiuc007ntp.3 mouse [Q8C7M3-1]
uc007nts.2 mouse [Q8C7M3-2]
uc011ynj.2 mouse [Q8C7M3-3]
uc011ynl.1 mouse [Q8C7M3-6]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049907 mRNA Translation: BAC33982.1
AK034029 mRNA Translation: BAC28552.1
AK028280 mRNA Translation: BAC25854.1
AK048875 mRNA Translation: BAC33479.1
AK129109 mRNA Translation: BAC97919.1 Different initiation.
BC052034 mRNA Translation: AAH52034.1
AF220039 mRNA Translation: AAG53493.1
CCDSiCCDS49077.1 [Q8C7M3-3]
RefSeqiNP_001103672.1, NM_001110202.1 [Q8C7M3-3]
NP_001103673.1, NM_001110203.1
NP_001273315.1, NM_001286386.1 [Q8C7M3-6]
NP_001273316.1, NM_001286387.1
NP_001273317.1, NM_001286388.1
NP_444397.2, NM_053167.3
UniGeneiMm.184012

3D structure databases

ProteinModelPortaliQ8C7M3
SMRiQ8C7M3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi220445, 5 interactors
IntActiQ8C7M3, 1 interactor
MINTiQ8C7M3
STRINGi10090.ENSMUSP00000106151

PTM databases

iPTMnetiQ8C7M3
PhosphoSitePlusiQ8C7M3

Proteomic databases

PaxDbiQ8C7M3
PeptideAtlasiQ8C7M3
PRIDEiQ8C7M3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000110520; ENSMUSP00000106149; ENSMUSG00000021071 [Q8C7M3-3]
ENSMUST00000221041; ENSMUSP00000152496; ENSMUSG00000021071 [Q8C7M3-4]
ENSMUST00000221370; ENSMUSP00000152692; ENSMUSG00000021071 [Q8C7M3-6]
ENSMUST00000222316; ENSMUSP00000152147; ENSMUSG00000021071 [Q8C7M3-1]
GeneIDi94090
KEGGimmu:94090
UCSCiuc007ntp.3 mouse [Q8C7M3-1]
uc007nts.2 mouse [Q8C7M3-2]
uc011ynj.2 mouse [Q8C7M3-3]
uc011ynl.1 mouse [Q8C7M3-6]

Organism-specific databases

CTDi114088
MGIiMGI:2137354 Trim9
RougeiSearch...

Phylogenomic databases

eggNOGiKOG4367 Eukaryota
ENOG410XQMV LUCA
GeneTreeiENSGT00760000118878
HOVERGENiHBG062305
InParanoidiQ8C7M3
KOiK10649
OMAiHGTHEVK
PhylomeDBiQ8C7M3

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRSiTrim9 mouse
PROiPR:Q8C7M3
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021071 Expressed in 193 organ(s), highest expression level in piriform cortex
CleanExiMM_TRIM9
ExpressionAtlasiQ8C7M3 baseline and differential
GenevisibleiQ8C7M3 MM

Family and domain databases

CDDicd00063 FN3, 1 hit
Gene3Di2.60.40.10, 1 hit
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001870 B30.2/SPRY
IPR003649 Bbox_C
IPR013320 ConA-like_dom_sf
IPR017903 COS_domain
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
IPR003877 SPRY_dom
IPR035029 TRIM9
IPR000315 Znf_B-box
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PANTHERiPTHR44104:SF3 PTHR44104:SF3, 1 hit
PfamiView protein in Pfam
PF00041 fn3, 1 hit
PF00622 SPRY, 1 hit
PF00643 zf-B_box, 1 hit
SMARTiView protein in SMART
SM00502 BBC, 1 hit
SM00336 BBOX, 2 hits
SM00060 FN3, 1 hit
SM00184 RING, 1 hit
SM00449 SPRY, 1 hit
SUPFAMiSSF49265 SSF49265, 1 hit
SSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50188 B302_SPRY, 1 hit
PS51262 COS, 1 hit
PS50853 FN3, 1 hit
PS50119 ZF_BBOX, 2 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTRIM9_MOUSE
AccessioniPrimary (citable) accession number: Q8C7M3
Secondary accession number(s): Q6ZQE5
, Q80WT6, Q8C7Z4, Q8CC32, Q8CEG2, Q99PQ3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 4, 2003
Last sequence update: August 4, 2003
Last modified: November 7, 2018
This is version 149 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again