Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (02 Jun 2021)
Sequence version 2 (04 Aug 2003)
Previous versions | rss
Add a publicationFeedback
Protein

E3 ubiquitin-protein ligase TRIM9

Gene

Trim9

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase which ubiquitinates itself in cooperation with an E2 enzyme UBE2D2/UBC4 and serves as a targeting signal for proteasomal degradation. May play a role in regulation of neuronal functions. May act as a regulator of synaptic vesicle exocytosis by controlling the availability of SNAP25 for the SNARE complex formation.

By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.By similarity EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.By similarity
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi168Zinc 1PROSITE-ProRule annotation1
Metal bindingi171Zinc 1PROSITE-ProRule annotation1
Metal bindingi193Zinc 1PROSITE-ProRule annotation1
Metal bindingi198Zinc 1PROSITE-ProRule annotation1
Metal bindingi229Zinc 2PROSITE-ProRule annotation1
Metal bindingi232Zinc 2PROSITE-ProRule annotation1
Metal bindingi252Zinc 2PROSITE-ProRule annotation1
Metal bindingi258Zinc 2PROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri10 – 50RING-typePROSITE-ProRule annotationAdd BLAST41
Zinc fingeri163 – 212B box-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri224 – 266B box-type 2PROSITE-ProRule annotationAdd BLAST43

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-983168, Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM9 (EC:2.3.2.27By similarity)
Alternative name(s):
RING-type E3 ubiquitin transferase TRIM9Curated
Tripartite motif-containing protein 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Trim9
Synonyms:Kiaa0282
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2137354, Trim9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000562091 – 817E3 ubiquitin-protein ligase TRIM9Add BLAST817

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei41PhosphothreonineCombined sources1
Modified residuei44PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Modified residuei49PhosphoserineCombined sources1
Modified residuei53PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Auto-ubiquitinated.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8C7M3

PeptideAtlas

More...
PeptideAtlasi
Q8C7M3

PRoteomics IDEntifications database

More...
PRIDEi
Q8C7M3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
298306 [Q8C7M3-1]
298307 [Q8C7M3-2]
298308 [Q8C7M3-3]
298309 [Q8C7M3-4]
298310 [Q8C7M3-5]
298311 [Q8C7M3-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8C7M3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8C7M3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain. Expression is higher in the cerebral cortex and hippocampus (at protein level). Its expression is mainly confined to the central nervous system. The developing neocortex, the dorsal thalamus, the midbrain, the basal area of the hindbrain and spinal cord show high level of expression during embryogenesis. In adult brain, it is detected in the Purkinje cells of the cerebellum, in the hippocampus, and in the cortex.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

First seen at 9.5 dpc. From 9.5 dpc to 11.5 dpc, it remains uniformly present in the ventral part of the entire neuroepithelium and in the dorsal root ganglia. A more restricted central nervous system (CNS) expression is observed at 13.5 dpc and 15.5 dpc when it is present in specific regions of the forebrain, midbrain, hindbrain and spinal cord.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000021071, Expressed in piriform cortex and 226 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q8C7M3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8C7M3, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SNAP25.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
220445, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q8C7M3, 1 interactor

Molecular INTeraction database

More...
MINTi
Q8C7M3

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106151

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8C7M3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q8C7M3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini374 – 432COSPROSITE-ProRule annotationAdd BLAST59
Domaini440 – 535Fibronectin type-IIIPROSITE-ProRule annotationAdd BLAST96
Domaini613 – 794B30.2/SPRYPROSITE-ProRule annotationAdd BLAST182

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni535 – 557DisorderedSequence analysisAdd BLAST23

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili273 – 340Sequence analysisAdd BLAST68

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The coiled coil domain mediates the interaction with the N-terminal t-SNARE domain of SNAP25.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRIM/RBCC family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri10 – 50RING-typePROSITE-ProRule annotationAdd BLAST41
Zinc fingeri163 – 212B box-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri224 – 266B box-type 2PROSITE-ProRule annotationAdd BLAST43

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4367, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154071

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_013137_19_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8C7M3

Identification of Orthologs from Complete Genome Data

More...
OMAi
YLHNETH

Database of Orthologous Groups

More...
OrthoDBi
516512at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8C7M3

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063, FN3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.920, 1 hit
2.60.40.10, 1 hit
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001870, B30.2/SPRY
IPR043136, B30.2/SPRY_sf
IPR003649, Bbox_C
IPR013320, ConA-like_dom_sf
IPR017903, COS_domain
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
IPR003877, SPRY_dom
IPR000315, Znf_B-box
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041, fn3, 1 hit
PF00622, SPRY, 1 hit
PF00643, zf-B_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00502, BBC, 1 hit
SM00336, BBOX, 2 hits
SM00060, FN3, 1 hit
SM00184, RING, 1 hit
SM00449, SPRY, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265, SSF49265, 1 hit
SSF49899, SSF49899, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50188, B302_SPRY, 1 hit
PS51262, COS, 1 hit
PS50853, FN3, 1 hit
PS50119, ZF_BBOX, 2 hits
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C7M3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEMEEELKC PVCGSFYREP IILPCSHNLC QACARNILVQ TPESESPQSR
60 70 80 90 100
RASGSGVSDY DYLDLDKMSL YSEADSGYGS YGGFASAPTT PCQKSPNGVR
110 120 130 140 150
VFPPAMPPPP THLSPALAPV PRNSCITCPQ CHRSLILDDR GLRGFPKNRV
160 170 180 190 200
LEGVIDRYQQ SKAAALKCQL CEKAPKEATV MCEQCDVFYC DPCRLRCHPP
210 220 230 240 250
RGPLAKHRLV PPAQGRVSRR LSPRKVSTCT DHELENHSMY CVQCKMPVCY
260 270 280 290 300
QCLEEGKHSS HEVKALGAMW KLHKSQLSQA LNGLSDRAKE AKEFLVQLRT
310 320 330 340 350
MVQQIQENSV EFEACLVAQC DALIDALNRR KAQLLARVNK EHEHKLKVVR
360 370 380 390 400
DQISHCTVKL RQTTGLMEYC LEVIKENDPS GFLQISDALI RRVHLTEDQW
410 420 430 440 450
GKGTLTPRMT TDFDLSLDNS PLLQSIHQLD FVQVKASSPV PATPILQLEE
460 470 480 490 500
CCTHNNSATL SWKQPPLSTV AADGYILELD DGSGGQFREV YVGKETMCTV
510 520 530 540 550
DGLHFNSTYN ARVKAFNKTG VSPYSKTLVL QTSEAAGAHE TKPMKDTDSE
560 570 580 590 600
EQTLPFPVPS ERLPLRRMSP FSSTLNLQPS FPGRSYFDFR SSPHQLSLHS
610 620 630 640 650
SLQSLNAPGC NFETQSASYS QLVDIKKLLA VAWFAFDPGS AHSDIIFSND
660 670 680 690 700
NLTVTCSSYD DRVVLGKTGF SKGVHYWELT IDRYDNHPDP AFGVARIDVM
710 720 730 740 750
KDMMLGKDDK AWAMYVDNNR SWFMHNNSHT NRTEGGITKG ATIGVLLDLN
760 770 780 790 800
RKTLTFFVNN EQQGPIAFEN VEGLFFPAVS LNRNVQVSLW APGLRACSGC
810
YFKVCPGAVK SPQAPAP
Note: May be due to an intron retention.
Length:817
Mass (Da):90,870
Last modified:August 4, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF23A355F6FF5762D
GO
Isoform 2 (identifier: Q8C7M3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I

Note: May be due to a competing acceptor splice site and to an exon skipping.Curated
Show »
Length:798
Mass (Da):88,507
Checksum:iF078FC75904D43DC
GO
Isoform 3 (identifier: Q8C7M3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-608: Missing.
     714-732: MYVDNNRSWFMHNNSHTNR → I
     788-817: SLWAPGLRACSGCYFKVCPGAVKSPQAPAP → TLHTGLPVPDFYSSRASIA

Note: May be due to a competing donor splice site and ?.Curated
Show »
Length:714
Mass (Da):79,311
Checksum:i5395B4EDC3465ADD
GO
Isoform 4 (identifier: Q8C7M3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     546-565: DTDSEEQTLPFPVPSERLPL → GMCGWRQSILRLLGIVLLVD
     566-817: Missing.

Note: May be due to an intron retention.Curated
Show »
Length:565
Mass (Da):62,861
Checksum:i0F105433DEBFC20A
GO
Isoform 5 (identifier: Q8C7M3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-630: Missing.

Note: May be due to exon skipping.Curated
Show »
Length:721
Mass (Da):80,236
Checksum:i291E76ECE8DAAA5E
GO
Isoform 6 (identifier: Q8C7M3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-536: AA → GR
     537-817: Missing.

Note: May be due to an exon inclusion.Curated
Show »
Length:536
Mass (Da):59,727
Checksum:i32EBC120E3D71B91
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QLH4E9QLH4_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
788Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1Y7VP88A0A1Y7VP88_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
710Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q524E9Q524_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
547Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A6I8MWZ7A0A6I8MWZ7_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
550Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1Y7VJX8A0A1Y7VJX8_MOUSE
E3 ubiquitin-protein ligase TRIM9
Trim9
772Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC97919 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti27H → D in BAC28552 (PubMed:16141072).Curated1
Sequence conflicti251Q → H in BAC33982 (PubMed:16141072).Curated1
Sequence conflicti254E → Q in BAC33982 (PubMed:16141072).Curated1
Sequence conflicti319Q → R in AAG53493 (PubMed:11331580).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007932535 – 630Missing in isoform 5. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_007931535 – 608Missing in isoform 3. 2 PublicationsAdd BLAST74
Alternative sequenceiVSP_007933535 – 536AA → GR in isoform 6. 1 Publication2
Alternative sequenceiVSP_007930535Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_007934537 – 817Missing in isoform 6. 1 PublicationAdd BLAST281
Alternative sequenceiVSP_007937546 – 565DTDSE…ERLPL → GMCGWRQSILRLLGIVLLVD in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_007938566 – 817Missing in isoform 4. 1 PublicationAdd BLAST252
Alternative sequenceiVSP_007935714 – 732MYVDN…SHTNR → I in isoform 2 and isoform 3. 2 PublicationsAdd BLAST19
Alternative sequenceiVSP_007936788 – 817SLWAP…QAPAP → TLHTGLPVPDFYSSRASIA in isoform 3. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK049907 mRNA Translation: BAC33982.1
AK034029 mRNA Translation: BAC28552.1
AK028280 mRNA Translation: BAC25854.1
AK048875 mRNA Translation: BAC33479.1
AK129109 mRNA Translation: BAC97919.1 Different initiation.
BC052034 mRNA Translation: AAH52034.1
AF220039 mRNA Translation: AAG53493.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS49077.1 [Q8C7M3-3]
CCDS88348.1 [Q8C7M3-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001103672.1, NM_001110202.1 [Q8C7M3-3]
NP_001103673.1, NM_001110203.1
NP_001273315.1, NM_001286386.1 [Q8C7M3-6]
NP_001273316.1, NM_001286387.1
NP_001273317.1, NM_001286388.1
NP_444397.2, NM_053167.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000110520; ENSMUSP00000106149; ENSMUSG00000021071 [Q8C7M3-3]
ENSMUST00000221041; ENSMUSP00000152496; ENSMUSG00000021071 [Q8C7M3-4]
ENSMUST00000221370; ENSMUSP00000152692; ENSMUSG00000021071 [Q8C7M3-6]
ENSMUST00000222316; ENSMUSP00000152147; ENSMUSG00000021071 [Q8C7M3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
94090

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:94090

UCSC genome browser

More...
UCSCi
uc007ntp.3, mouse [Q8C7M3-1]
uc007nts.2, mouse [Q8C7M3-2]
uc011ynj.2, mouse [Q8C7M3-3]
uc011ynl.1, mouse [Q8C7M3-6]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK049907 mRNA Translation: BAC33982.1
AK034029 mRNA Translation: BAC28552.1
AK028280 mRNA Translation: BAC25854.1
AK048875 mRNA Translation: BAC33479.1
AK129109 mRNA Translation: BAC97919.1 Different initiation.
BC052034 mRNA Translation: AAH52034.1
AF220039 mRNA Translation: AAG53493.1
CCDSiCCDS49077.1 [Q8C7M3-3]
CCDS88348.1 [Q8C7M3-6]
RefSeqiNP_001103672.1, NM_001110202.1 [Q8C7M3-3]
NP_001103673.1, NM_001110203.1
NP_001273315.1, NM_001286386.1 [Q8C7M3-6]
NP_001273316.1, NM_001286387.1
NP_001273317.1, NM_001286388.1
NP_444397.2, NM_053167.3

3D structure databases

SMRiQ8C7M3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi220445, 9 interactors
IntActiQ8C7M3, 1 interactor
MINTiQ8C7M3
STRINGi10090.ENSMUSP00000106151

PTM databases

iPTMnetiQ8C7M3
PhosphoSitePlusiQ8C7M3

Proteomic databases

PaxDbiQ8C7M3
PeptideAtlasiQ8C7M3
PRIDEiQ8C7M3
ProteomicsDBi298306 [Q8C7M3-1]
298307 [Q8C7M3-2]
298308 [Q8C7M3-3]
298309 [Q8C7M3-4]
298310 [Q8C7M3-5]
298311 [Q8C7M3-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
10667, 475 antibodies

The DNASU plasmid repository

More...
DNASUi
94090

Genome annotation databases

EnsembliENSMUST00000110520; ENSMUSP00000106149; ENSMUSG00000021071 [Q8C7M3-3]
ENSMUST00000221041; ENSMUSP00000152496; ENSMUSG00000021071 [Q8C7M3-4]
ENSMUST00000221370; ENSMUSP00000152692; ENSMUSG00000021071 [Q8C7M3-6]
ENSMUST00000222316; ENSMUSP00000152147; ENSMUSG00000021071 [Q8C7M3-1]
GeneIDi94090
KEGGimmu:94090
UCSCiuc007ntp.3, mouse [Q8C7M3-1]
uc007nts.2, mouse [Q8C7M3-2]
uc011ynj.2, mouse [Q8C7M3-3]
uc011ynl.1, mouse [Q8C7M3-6]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
114088
MGIiMGI:2137354, Trim9

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG4367, Eukaryota
GeneTreeiENSGT00940000154071
HOGENOMiCLU_013137_19_2_1
InParanoidiQ8C7M3
OMAiYLHNETH
OrthoDBi516512at2759
PhylomeDBiQ8C7M3

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-MMU-983168, Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
94090, 1 hit in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Trim9, mouse

Protein Ontology

More...
PROi
PR:Q8C7M3
RNActiQ8C7M3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000021071, Expressed in piriform cortex and 226 other tissues
ExpressionAtlasiQ8C7M3, baseline and differential
GenevisibleiQ8C7M3, MM

Family and domain databases

CDDicd00063, FN3, 1 hit
Gene3Di2.60.120.920, 1 hit
2.60.40.10, 1 hit
3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR001870, B30.2/SPRY
IPR043136, B30.2/SPRY_sf
IPR003649, Bbox_C
IPR013320, ConA-like_dom_sf
IPR017903, COS_domain
IPR003961, FN3_dom
IPR036116, FN3_sf
IPR013783, Ig-like_fold
IPR003877, SPRY_dom
IPR000315, Znf_B-box
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS
PfamiView protein in Pfam
PF00041, fn3, 1 hit
PF00622, SPRY, 1 hit
PF00643, zf-B_box, 1 hit
SMARTiView protein in SMART
SM00502, BBC, 1 hit
SM00336, BBOX, 2 hits
SM00060, FN3, 1 hit
SM00184, RING, 1 hit
SM00449, SPRY, 1 hit
SUPFAMiSSF49265, SSF49265, 1 hit
SSF49899, SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50188, B302_SPRY, 1 hit
PS51262, COS, 1 hit
PS50853, FN3, 1 hit
PS50119, ZF_BBOX, 2 hits
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRIM9_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8C7M3
Secondary accession number(s): Q6ZQE5
, Q80WT6, Q8C7Z4, Q8CC32, Q8CEG2, Q99PQ3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 4, 2003
Last sequence update: August 4, 2003
Last modified: June 2, 2021
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again