Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (23 Feb 2022)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Katanin-interacting protein

Gene

Katnip

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May influence the stability of microtubules (MT), possibly through interaction with the MT-severing katanin complex.

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Katanin-interacting protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Katnip
Synonyms:Kiaa0556
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2442760, Katnip

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000032743

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Knockout mice frequently display brain-specific defects, resulting in a noncommunicating (obstructive) hydrocephalus.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003130911 – 1610Katanin-interacting proteinAdd BLAST1610

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei658PhosphoserineBy similarity1
Modified residuei688PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q8C753

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q8C753

PRoteomics IDEntifications database

More...
PRIDEi
Q8C753

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q8C753

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q8C753

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000032743, Expressed in retinal neural layer and 257 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q8C753, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with microtubules.

Interacts with 4 subunits of the katanin complex: KATNA1, KATNAL1, KATNB1 and KATNBL1.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
231458, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000065744

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q8C753, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 24DisorderedSequence analysisAdd BLAST24
Regioni84 – 105DisorderedSequence analysisAdd BLAST22
Regioni118 – 137DisorderedSequence analysisAdd BLAST20
Regioni173 – 236DisorderedSequence analysisAdd BLAST64
Regioni305 – 333DisorderedSequence analysisAdd BLAST29
Regioni702 – 722DisorderedSequence analysisAdd BLAST21
Regioni760 – 821DisorderedSequence analysisAdd BLAST62
Regioni836 – 875DisorderedSequence analysisAdd BLAST40
Regioni927 – 951DisorderedSequence analysisAdd BLAST25

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili330 – 354Sequence analysisAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi84 – 104Polar residuesSequence analysisAdd BLAST21
Compositional biasi184 – 199Polar residuesSequence analysisAdd BLAST16
Compositional biasi200 – 215Acidic residuesSequence analysisAdd BLAST16
Compositional biasi219 – 236Basic and acidic residuesSequence analysisAdd BLAST18
Compositional biasi311 – 333Basic and acidic residuesSequence analysisAdd BLAST23
Compositional biasi771 – 787Basic and acidic residuesSequence analysisAdd BLAST17
Compositional biasi794 – 809Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi848 – 871Basic and acidic residuesSequence analysisAdd BLAST24
Compositional biasi927 – 947Basic and acidic residuesSequence analysisAdd BLAST21

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRY1, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004566

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003418_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q8C753

Identification of Orthologs from Complete Genome Data

More...
OMAi
FVDYLQP

Database of Orthologous Groups

More...
OrthoDBi
361541at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q8C753

TreeFam database of animal gene trees

More...
TreeFami
TF314150

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026704, KATNIP
IPR027859, KATNIP_dom

The PANTHER Classification System

More...
PANTHERi
PTHR21534, PTHR21534, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14652, DUF4457, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C753-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGQALRKVE RSRSCSQERK EGYSKDMVTD FDEKHDEYLI LLQQRNRILK
60 70 80 90 100
HLKAKDPVQL RLEHLEQGFS VYVNGANSEL KTSPRKAVHT DFSRSASQAE
110 120 130 140 150
GSQDYGRRTL FREAEEVLRR SSRTAPGKVQ RRGWHQKSVQ IRTEAGSRLH
160 170 180 190 200
IEPPLDCSED FESQEDVIGK HEDATGEHTQ ELRKGLGLST SLQTQEDGSS
210 220 230 240 250
DEYDSIEEDV LSETETEDPV LPVHNRDECP LPSHDAVQKD VPKDQELEGR
260 270 280 290 300
HPQATDTLVV MEFNPASKGN KMDRILSAKR KENAEVFIPS KPDSVLNPQP
310 320 330 340 350
PAVFPEQERA CSRSGSRRDR PLSATRKAYA AEDREEDASA VLKAIQVENE
360 370 380 390 400
ALQQVFLSHD PELHTSPQQD TKEPPAKSWS SLLKAKEDIP ELLPATPVTT
410 420 430 440 450
DPELCRAAAG AKAVSQAMDG MSPLGSRQQH KLVGVLQTME SDTTHLSQVA
460 470 480 490 500
IPTEKPVPNS EEKWKARVDE IEDAIYVTME ILSNWGNASW VGLTEVQFFD
510 520 530 540 550
LNNIKLYVSP HDVDIRNAVL PGELGCLVNR DLVSKKDPPV WTCPFHPPLQ
560 570 580 590 600
LYFIIHNMRQ LRDFGLTMIK VRNYWTADGD LDIGAKNVKL YVNKSLIFDG
610 620 630 640 650
VLEKGGGEAP SDCTIPVDLQ RERNESSDKA LSTGWKESKG ALKMAALSDA
660 670 680 690 700
RELGLSCSQP AESLDMTVSS QGDFLGEKVN STSGLKNSLS KLQEDVRLLA
710 720 730 740 750
TPASMGDGPS VPSSSSPGKC LPLEEEPSLI QQLESLRGRK IPEPTGKTPH
760 770 780 790 800
WLQPSLAGMG KKQTVRKPKP LWLSPEKDLE QKSRFPSEDV MGDTPGEVET
810 820 830 840 850
REKGPRREQG RTSSWNVITE ERAPKAFSKA CGDDLDIFSQ LPNRDRPASG
860 870 880 890 900
RRALKKEASS SHGDDRPASK EDTQASQTLP WLQWYGEQEH ALHASWDSLT
910 920 930 940 950
AFDRAHRGRI SALEPQGDIL DEFLKQQRSS RHEEFPAPCR EEEPEPSTEM
960 970 980 990 1000
GGDSDFKIPV LPYGQHLVID IKSTWGDRHY VGLNGIEIFS SSGEPVQISS
1010 1020 1030 1040 1050
ITADPPDINI LPAYGKDPRV VSNLIDGVNR TQDDMHVWLA PFTPGMTHTI
1060 1070 1080 1090 1100
SIEFTHPCQV ALIRIWNYNK SRIHSFRGVK DITMLLDTQC IFEGEIAKAS
1110 1120 1130 1140 1150
GTLMGAPEHF GDTILFTMDE DILEAIFCLD DTFDMDAESL CGLQPEEALR
1160 1170 1180 1190 1200
RPSTADGEGQ DERPFTQAGL GAQDQVPGLE LQTSPPVSEV TTPEPGIFYG
1210 1220 1230 1240 1250
LCLRLNLTAS WGDLHYIGLT GLEVVGKDGE ALPIQPHQLS ASPRDLNDLP
1260 1270 1280 1290 1300
EYNDDSRTLD KLIDGMNITT EDEHMWLIPF SPGLDHVVMI HFDRAQSIAG
1310 1320 1330 1340 1350
LRLWNYNKSP EDTYRGVKIA HVSLDGLCVS PAEGFLIRKG PGNCHFDFAQ
1360 1370 1380 1390 1400
EILFGDYLQT RLPPAPTRRL DAKSLERASM DYEAPLMPCG FIFQFQLLSS
1410 1420 1430 1440 1450
WGDPYYIGLT GLELYDEHGE RIPLSQNNIA AFPDSVNALE GVCGDVRTPD
1460 1470 1480 1490 1500
KLIDQVNDTS DGRHMWLAPI LPGLVNRVYV IFDLPTTVSM IKLWNYTKTP
1510 1520 1530 1540 1550
QRGVKEFGLL VDDLLVYNGI LAMVSHLVGG ILPTCEPTVP HHTILFAEDT
1560 1570 1580 1590 1600
DFCHQEKHAI ISKPEEDQDI QMMNENQVIT TSRRKPGTAD PALRPKTCIR
1610
EKETSRRWRC
Length:1,610
Mass (Da):179,609
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC48BE0ACA94B0149
GO
Isoform 2 (identifier: Q8C753-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-260: Missing.
     1262-1278: LIDGMNITTEDEHMWLI → CPFTVALSPAGTDCLGS
     1280-1610: Missing.

Show »
Length:1,019
Mass (Da):112,302
Checksum:i239D6C28398728A3
GO
Isoform 3 (identifier: Q8C753-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     738-870: Missing.

Show »
Length:1,477
Mass (Da):164,782
Checksum:iADAD267792C293BB
GO
Isoform 4 (identifier: Q8C753-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1476-1508: NRVYVIFDLPTTVSMIKLWNYTKTPQRGVKEFG → PKLPTLQRSLGLGRVWEAGRVRGAGLTGAGPTLSQ

Show »
Length:1,612
Mass (Da):179,307
Checksum:iA570F5A92B1DFE03
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6XQI1F6XQI1_MOUSE
Katanin-interacting protein
Katnip D430042O09Rik
1,584Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z212D3Z212_MOUSE
Katanin-interacting protein
Katnip D430042O09Rik
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6UDS6F6UDS6_MOUSE
Katanin-interacting protein
Katnip D430042O09Rik
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH30902 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAH42743 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti144 – 147EAGS → HASA in AAH42743 (PubMed:15489334).Curated4
Sequence conflicti513 – 533VDIRN…NRDLV → GPFALKTGRNVSNSSHPLAF Q in BAC35016 (PubMed:16141072).CuratedAdd BLAST21
Sequence conflicti549 – 558LQLYFIIHNM → PLSLPFDVLH in AAH42743 (PubMed:15489334).Curated10
Sequence conflicti1093E → Q in BAC65591 (PubMed:12693553).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0300091 – 260Missing in isoform 2. 1 PublicationAdd BLAST260
Alternative sequenceiVSP_030010738 – 870Missing in isoform 3. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_0300111262 – 1278LIDGM…HMWLI → CPFTVALSPAGTDCLGS in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_0300121280 – 1610Missing in isoform 2. 1 PublicationAdd BLAST331
Alternative sequenceiVSP_0300131476 – 1508NRVYV…VKEFG → PKLPTLQRSLGLGRVWEAGR VRGAGLTGAGPTLSQ in isoform 4. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC002551 Genomic DNA No translation available.
AC008732 Genomic DNA No translation available.
AC016597 Genomic DNA No translation available.
AC092330 Genomic DNA No translation available.
AK052492 mRNA Translation: BAC35016.1
AK052528 mRNA Translation: BAC35027.1
BC030902 mRNA Translation: AAH30902.1 Different initiation.
BC042743 mRNA Translation: AAH42743.1 Different initiation.
AK122309 Transcribed RNA Translation: BAC65591.3

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS40123.1 [Q8C753-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001074491.1, NM_001081022.1 [Q8C753-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000069660; ENSMUSP00000065744; ENSMUSG00000032743 [Q8C753-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
233865

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:233865

UCSC genome browser

More...
UCSCi
uc009jqm.1, mouse [Q8C753-1]
uc009jqn.1, mouse [Q8C753-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC002551 Genomic DNA No translation available.
AC008732 Genomic DNA No translation available.
AC016597 Genomic DNA No translation available.
AC092330 Genomic DNA No translation available.
AK052492 mRNA Translation: BAC35016.1
AK052528 mRNA Translation: BAC35027.1
BC030902 mRNA Translation: AAH30902.1 Different initiation.
BC042743 mRNA Translation: AAH42743.1 Different initiation.
AK122309 Transcribed RNA Translation: BAC65591.3
CCDSiCCDS40123.1 [Q8C753-1]
RefSeqiNP_001074491.1, NM_001081022.1 [Q8C753-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi231458, 2 interactors
STRINGi10090.ENSMUSP00000065744

PTM databases

iPTMnetiQ8C753
PhosphoSitePlusiQ8C753

Proteomic databases

MaxQBiQ8C753
PaxDbiQ8C753
PRIDEiQ8C753

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26294, 29 antibodies from 10 providers

Genome annotation databases

EnsembliENSMUST00000069660; ENSMUSP00000065744; ENSMUSG00000032743 [Q8C753-1]
GeneIDi233865
KEGGimmu:233865
UCSCiuc009jqm.1, mouse [Q8C753-1]
uc009jqn.1, mouse [Q8C753-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23247
MGIiMGI:2442760, Katnip
VEuPathDBiHostDB:ENSMUSG00000032743

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG502QRY1, Eukaryota
GeneTreeiENSGT00390000004566
HOGENOMiCLU_003418_0_1_1
InParanoidiQ8C753
OMAiFVDYLQP
OrthoDBi361541at2759
PhylomeDBiQ8C753
TreeFamiTF314150

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
233865, 1 hit in 64 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
D430042O09Rik, mouse

Protein Ontology

More...
PROi
PR:Q8C753
RNActiQ8C753, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000032743, Expressed in retinal neural layer and 257 other tissues
GenevisibleiQ8C753, MM

Family and domain databases

InterProiView protein in InterPro
IPR026704, KATNIP
IPR027859, KATNIP_dom
PANTHERiPTHR21534, PTHR21534, 1 hit
PfamiView protein in Pfam
PF14652, DUF4457, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKATIP_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q8C753
Secondary accession number(s): Q80TX9
, Q8C759, Q8CFE1, Q8K0N9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: February 23, 2022
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again