Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein lin-9 homolog

Gene

Lin9

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a tumor suppressor. Inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. Plays a role in the expression of genes required for the G1/S transition (By similarity).By similarity

GO - Molecular functioni

  • DNA binding Source: GO_Central

GO - Biological processi

Keywordsi

Biological processCell cycle, DNA synthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Protein lin-9 homolog
Short name:
mLin-9
Alternative name(s):
TUDOR gene similar 1 protein
Type I interferon receptor beta chain-associated protein
Gene namesi
Name:Lin9
Synonyms:Bara, Tgs1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1919818 Lin9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002495482 – 542Protein lin-9 homologAdd BLAST541

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Cross-linki21Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei65PhosphoserineBy similarity1
Modified residuei95PhosphoserineCombined sources1
Modified residuei96PhosphothreonineBy similarity1
Modified residuei304PhosphothreonineCombined sources1
Modified residuei309PhosphoserineCombined sources1
Modified residuei321PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ8C735
PaxDbiQ8C735
PeptideAtlasiQ8C735
PRIDEiQ8C735

PTM databases

iPTMnetiQ8C735
PhosphoSitePlusiQ8C735

Expressioni

Gene expression databases

CleanExiMM_LIN9
GenevisibleiQ8C735 MM

Interactioni

Subunit structurei

Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2. Interacts with RB1 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000082959

Family & Domainsi

Sequence similaritiesi

Belongs to the lin-9 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG1019 Eukaryota
ENOG410YA1T LUCA
HOGENOMiHOG000007517
HOVERGENiHBG057743
InParanoidiQ8C735
PhylomeDBiQ8C735
TreeFamiTF314315

Family and domain databases

InterProiView protein in InterPro
IPR033471 DIRP
IPR010561 LIN-9/ALY1
PANTHERiPTHR21689 PTHR21689, 1 hit
PfamiView protein in Pfam
PF06584 DIRP, 1 hit
SMARTiView protein in SMART
SM01135 DIRP, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q8C735-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELDQLPDE SSSAKALVSL KEGSLSNTWN EKYSSLQKTP VWKGRNAGPA
60 70 80 90 100
VEMPFRNSKR SRLFSDEDDR QINTKSPKRN QRVAMIPQKF TATMSTPDKK
110 120 130 140 150
ASQKIGFRLR NLLKLPKAHK WCIYEWFYSN IDKPLFEGDN DFCVCLKESF
160 170 180 190 200
PNLKTRKLTR VEWGKIRRLM GKPRRCSSAF FEEERSALKQ KRQKIRLLQQ
210 220 230 240 250
RKVADVSQFK DLPDEIPLPL VIGTKVTARL RGIHDGLFTG QIDAVDTLNA
260 270 280 290 300
TYRVTFDRTG LGTHTIPDYE VLSNEPHETM PISAFGQKQR PSRFFMTPPR
310 320 330 340 350
LHYTPPLQSP ITDGDPLLGQ SPWRSKVSGS DTETLGGFPV EFLIQVTKLS
360 370 380 390 400
KILMIKKEHI KKLREMNTEA EKLKSYSMPI GIEFQRRYAT IVLELEQLNK
410 420 430 440 450
DLNKVLHKVQ QYCYELAPDQ GLQPADQPTD MRRRCEEEAQ EIVRQANSAS
460 470 480 490 500
GQPCVENENL TDLISRLTAI LLQIKCLAEG GDLNSFEFKS LTDSLNDIKN
510 520 530 540
TIDASNISCF QNNVEIHVAH IQSGLSQMGN LHAFAANNTN RD
Length:542
Mass (Da):61,759
Last modified:September 19, 2006 - v2
Checksum:i9F99F9DB3D2568E4
GO
Isoform 2 (identifier: Q8C735-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     416-542: LAPDQGLQPA...AFAANNTNRD → VSGVYCFHWC...NDFTFTFCKL

Show »
Length:502
Mass (Da):57,632
Checksum:i016036D114A835E5
GO
Isoform 3 (identifier: Q8C735-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     176-205: CSSAFFEEERSALKQKRQKIRLLQQRKVAD → EISLKTEAAENQAVTTKESCRCFTVQRSPR
     206-542: Missing.

Note: No experimental confirmation available.
Show »
Length:205
Mass (Da):23,749
Checksum:i66167964175000D4
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A6YVZ7A0A0A6YVZ7_MOUSE
Protein lin-9 homolog
Lin9
558Annotation score:
A0A0A6YWF7A0A0A6YWF7_MOUSE
Protein lin-9 homolog
Lin9
272Annotation score:
A0A0A6YWD3A0A0A6YWD3_MOUSE
Protein lin-9 homolog
Lin9
518Annotation score:
A0A0A6YXQ9A0A0A6YXQ9_MOUSE
Protein lin-9 homolog
Lin9
73Annotation score:

Sequence cautioni

The sequence AAQ13712 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC31235 differs from that shown. Reason: Frameshift at position 18.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti152N → K in BAC35065 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020511176 – 205CSSAF…RKVAD → EISLKTEAAENQAVTTKESC RCFTVQRSPR in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_020512206 – 542Missing in isoform 3. 1 PublicationAdd BLAST337
Alternative sequenceiVSP_020513416 – 542LAPDQ…NTNRD → VSGVYCFHWCFVLFCFVILV FFEMGSHSVAMAALETSLAS SSEIRLFLPPSAGIKGVRHH AQPNVCCFPSMFCYLKLNDF TFTFCKL in isoform 2. 1 PublicationAdd BLAST127

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK042357 mRNA Translation: BAC31235.1 Frameshift.
AK052618 mRNA Translation: BAC35065.1
AF190325 mRNA Translation: AAQ13712.1 Different initiation.
UniGeneiMm.275044

Genome annotation databases

UCSCiuc007dwk.3 mouse [Q8C735-1]
uc007dwl.3 mouse [Q8C735-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK042357 mRNA Translation: BAC31235.1 Frameshift.
AK052618 mRNA Translation: BAC35065.1
AF190325 mRNA Translation: AAQ13712.1 Different initiation.
UniGeneiMm.275044

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000082959

PTM databases

iPTMnetiQ8C735
PhosphoSitePlusiQ8C735

Proteomic databases

EPDiQ8C735
PaxDbiQ8C735
PeptideAtlasiQ8C735
PRIDEiQ8C735

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiuc007dwk.3 mouse [Q8C735-1]
uc007dwl.3 mouse [Q8C735-2]

Organism-specific databases

MGIiMGI:1919818 Lin9

Phylogenomic databases

eggNOGiKOG1019 Eukaryota
ENOG410YA1T LUCA
HOGENOMiHOG000007517
HOVERGENiHBG057743
InParanoidiQ8C735
PhylomeDBiQ8C735
TreeFamiTF314315

Miscellaneous databases

PROiPR:Q8C735
SOURCEiSearch...

Gene expression databases

CleanExiMM_LIN9
GenevisibleiQ8C735 MM

Family and domain databases

InterProiView protein in InterPro
IPR033471 DIRP
IPR010561 LIN-9/ALY1
PANTHERiPTHR21689 PTHR21689, 1 hit
PfamiView protein in Pfam
PF06584 DIRP, 1 hit
SMARTiView protein in SMART
SM01135 DIRP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLIN9_MOUSE
AccessioniPrimary (citable) accession number: Q8C735
Secondary accession number(s): Q5TKA0, Q8C9D8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 19, 2006
Last modified: November 7, 2018
This is version 116 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again